Property Summary

Ligand Count 3
NCBI Gene PubMed Count 56
PubMed Score 211.00
PubTator Score 61.28

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (8)

Disease Target Count P-value
non-small cell lung cancer 2890 7.7e-26
lung adenocarcinoma 2716 1.8e-15
ovarian cancer 8519 2.2e-09
medulloblastoma, large-cell 6241 3.3e-04
osteosarcoma 7950 7.4e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
pancreatic cancer 2398 0.0 1.1
Disease Target Count Z-score Confidence
Intellectual disability 1016 4.207 2.1
Disease Target Count
3p- syndrome 21

Expression

  Differential Expression (5)

Disease log2 FC p
lung adenocarcinoma -1.400 1.8e-15
medulloblastoma, large-cell -1.100 3.3e-04
non-small cell lung cancer -1.254 7.7e-26
osteosarcoma 1.044 7.4e-03
ovarian cancer -1.500 2.2e-09

 GO Function (1)

Protein-protein Interaction (2)

Gene RIF (42)

AA Sequence

MAGEGDQQDAAHNMGNHLPLLPAESEEEDEMEVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGR      1 - 70
TLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQEREAQFGTTAE     71 - 140
IYAYREEQDFGIEIVKVKAIGRQRFKVLELRTQSDGIQQAKVQILPECVLPSTMSAVQLESLNKCQIFPS    141 - 210
KPVSREDQCSYKWWQKYQKRKFHCANLTSWPRWLYSLYDAETLMDRIKKQLREWDENLKDDSLPSNPIDF    211 - 280
SYRVAACLPIDDVLRIQLLKIGSAIQRLRCELDIMNKCTSLCCKQCQETEITTKNEIFSLSLCGPMAAYV    281 - 350
NPHGYVHETLTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGLTRS    351 - 420
ALLPTIPDTEDEISPDKVILCL                                                    421 - 442
//

Text Mined References (59)

PMID Year Title