Property Summary

NCBI Gene PubMed Count 40
Grant Count 30
R01 Count 19
Funding $6,566,088.02
PubMed Score 187.06
PubTator Score 61.28

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.044 0.007
medulloblastoma, large-cell -1.100 0.000
non-small cell lung cancer -1.353 0.000
lung adenocarcinoma -1.400 0.000
ovarian cancer -1.800 0.000

Gene RIF (28)

PMID Text
26990986 GS is acetylated at lysines 11 and 14, yielding a degron that is necessary and sufficient for binding and ubiquitylation by CRL4(CRBN) and degradation by the proteasome.
26188093 Although abnormal CRBN function may be associated with intellectual disability disease onset, its cellular mechanism is still unclear. Here, we examine the role of CRBN in aggresome formation and cytoprotection.
26119939 The anti-PEL effects of IMiDs involved cereblon-dependent suppression of IRF4 and rapid degradation of IKZF1, but not IKZF3. Small hairpin RNA-mediated knockdown of MYC enhanced the cytotoxicity of IMiDs
26024445 Structural dynamics of the cereblon ligand binding domain.
26021757 Our data are consistent with the idea that the CUL4A/B-DDB1-CRBN complex catalyses the polyubiquitination and thus controls the degradation of CLC-1 channels.
25858704 A copy number gain of CRBN gene might be responsible for developmental delay/intellectual disability.
25569776 Studied the protein cereblon , which has been recently indentified as a primary target of thalidomide and its C-terminal part as responsible for binding thalidomide within a domain carrying several invariant cysteine and tryptophan residues.
25284710 High levels of full-length CRBN mRNA in lower risk 5q deletion patients are necessary for the efficacy of lenalidomide.
25108355 The study presents the crystal structure of human CRBN bound to DDB1 and the drug lenalidomide.
25043012 structures of the DDB1-CRBN complex bound to thalidomide, lenalidomide and pomalidomide
More...

AA Sequence

MAGEGDQQDAAHNMGNHLPLLPAESEEEDEMEVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGR      1 - 70
TLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQEREAQFGTTAE     71 - 140
IYAYREEQDFGIEIVKVKAIGRQRFKVLELRTQSDGIQQAKVQILPECVLPSTMSAVQLESLNKCQIFPS    141 - 210
KPVSREDQCSYKWWQKYQKRKFHCANLTSWPRWLYSLYDAETLMDRIKKQLREWDENLKDDSLPSNPIDF    211 - 280
SYRVAACLPIDDVLRIQLLKIGSAIQRLRCELDIMNKCTSLCCKQCQETEITTKNEIFSLSLCGPMAAYV    281 - 350
NPHGYVHETLTVYKACNLNLIGRPSTEHSWFPGYAWTVAQCKICASHIGWKFTATKKDMSPQKFWGLTRS    351 - 420
ALLPTIPDTEDEISPDKVILCL                                                    421 - 442
//

Text Mined References (43)

PMID Year Title
26990986 2016 Glutamine Triggers Acetylation-Dependent Degradation of Glutamine Synthetase via the Thalidomide Receptor Cereblon.
26188093 2015 Cereblon is recruited to aggresome and shows cytoprotective effect against ubiquitin-proteasome system dysfunction.
26119939 2016 Immunomodulatory drugs target IKZF1-IRF4-MYC axis in primary effusion lymphoma in a cereblon-dependent manner and display synergistic cytotoxicity with BRD4 inhibitors.
26024445 2015 Structural dynamics of the cereblon ligand binding domain.
26021757 2015 The Cullin 4A/B-DDB1-Cereblon E3 Ubiquitin Ligase Complex Mediates the Degradation of CLC-1 Chloride Channels.
25858704 2015 Microduplications of 3p26.3p26.2 containing CRBN gene in patients with intellectual disability and behavior abnormalities.
25569776 2015 The thalidomide-binding domain of cereblon defines the CULT domain family and is a new member of the ?-tent fold.
25416956 2014 A proteome-scale map of the human interactome network.
25284710 2015 High level of full-length cereblon mRNA in lower risk myelodysplastic syndrome with isolated 5q deletion is implicated in the efficacy of lenalidomide.
25108355 2014 Structure of the human Cereblon-DDB1-lenalidomide complex reveals basis for responsiveness to thalidomide analogs.
More...