Property Summary

NCBI Gene PubMed Count 119
Grant Count 83
R01 Count 44
Funding $5,893,150.93
PubMed Score 62.87
PubTator Score 122.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -2.652 0.000
group 3 medulloblastoma 1.400 0.000
subependymal giant cell astrocytoma -1.198 0.017
psoriasis -1.200 0.000
ovarian cancer 1.900 0.000
pituitary cancer 1.300 0.000

Synonym

Accession Q96ST3 B2RNS5 Q8N8N4 Q8NC83 Q8WV18 Q96L98 Q9UFQ1
Symbols WITKOS

Gene

PDB

1PO4  

 GWAS Trait (1)

Gene RIF (38)

PMID Text
26671595 Two novel translocations leading to the inactivation of RUNX1 and its partners SIN3A and TCF12 in myeloid leukemia.
26118188 protein pairs significantly correlated with an increased risk of death in non-small cell lung cancer: mSin3A with p16, and c-Myc with mSinA
25611699 down regulation of miR-202 increased the expression of its target Mxd1, followed by Mxd1 recruitment to the Sin3A repressor complex and through its dimerization with Max, and increased repression of Myc-Max target proteins.
25481483 Aberrantly expressed miR-210 regulates human U251 glioma cells apoptosis and proliferation partly through directly down-regulating SIN3A protein expression.
25395209 Study suggests a lack of association of SIN3A gene sequence variants with azoospermia caused by Sertoli cell-only syndrome in humans.
25305016 SIN3A, generally regarded as a transcriptional repressor, is required for induction of gene transcription by the aryl hydrocarbon receptor.
24763403 Bone-marrow-specific deletion of Sin3a, indicated that Sin3a-associated HDAC1/2-activity is essential for hematopoietic stem cell homeostasis.
24344258 EBNA3C binds strongly to BATF/IRF4/SPI1/RUNX3 sites to enhance transcription and recruits RBPJ/Sin3A- and REST/NRSF-repressive complexes to repress p14(ARF) and p16(INK4A) expression
23633923 BIM silencing in anaplastic large cell lymphoma occurs through recruitment of MeCP2 and the SIN3a/histone deacetylase 1/2 corepressor complex.
22890320 reducing Sin3A strongly increased the invasive behavior of A549 human lung adenocarcinoma cells; findings show that Sin3A is downregulated in a variety of human tumors
More...

AA Sequence

MKRRLDDQESPVYAAQQRRIPGSTEAFPHQHRVLAPAPPVYEAVSETMQSATGIQYSVTPSYQVSAMPQS      1 - 70
SGSHGPAIAAVHSSHHHPTAVQPHGGQVVQSHAHPAPPVAPVQGQQQFQRLKVEDALSYLDQVKLQFGSQ     71 - 140
PQVYNDFLDIMKEFKSQSIDTPGVISRVSQLFKGHPDLIMGFNTFLPPGYKIEVQTNDMVNVTTPGQVHQ    141 - 210
IPTHGIQPQPQPPPQHPSQPSAQSAPAPAQPAPQPPPAKVSKPSQLQAHTPASQQTPPLPPYASPRSPPV    211 - 280
QPHTPVTISLGTAPSLQNNQPVEFNHAINYVNKIKNRFQGQPDIYKAFLEILHTYQKEQRNAKEAGGNYT    281 - 350
PALTEQEVYAQVARLFKNQEDLLSEFGQFLPDANSSVLLSKTTAEKVDSVRNDHGGTVKKPQLNNKPQRP    351 - 420
SQNGCQIRRHPTGTTPPVKKKPKLLNLKDSSMADASKHGGGTESLFFDKVRKALRSAEAYENFLRCLVIF    421 - 490
NQEVISRAELVQLVSPFLGKFPELFNWFKNFLGYKESVHLETYPKERATEGIAMEIDYASCKRLGSSYRA    491 - 560
LPKSYQQPKCTGRTPLCKEVLNDTWVSFPSWSEDSTFVSSKKTQYEEHIYRCEDERFELDVVLETNLATI    561 - 630
RVLEAIQKKLSRLSAEEQAKFRLDNTLGGTSEVIHRKALQRIYADKAADIIDGLRKNPSIAVPIVLKRLK    631 - 700
MKEEEWREAQRGFNKVWREQNEKYYLKSLDHQGINFKQNDTKVLRSKSLLNEIESIYDERQEQATEENAG    701 - 770
VPVGPHLSLAYEDKQILEDAAALIIHHVKRQTGIQKEDKYKIKQIMHHFIPDLLFAQRGDLSDVEEEEEE    771 - 840
EMDVDEATGAVKKHNGVGGSPPKSKLLFSNTAAQKLRGMDEVYNLFYVNNNWYIFMRLHQILCLRLLRIC    841 - 910
SQAERQIEEENREREWEREVLGIKRDKSDSPAIQLRLKEPMDVDVEDYYPAFLDMVRSLLDGNIDSSQYE    911 - 980
DSLREMFTIHAYIAFTMDKLIQSIVRQLQHIVSDEICVQVTDLYLAENNNGATGGQLNTQNSRSLLESTY    981 - 1050
QRKAEQLMSDENCFKLMFIQSQGQVQLTIELLDTEEENSDDPVEAERWSDYVERYMNSDTTSPELREHLA   1051 - 1120
QKPVFLPRNLRRIRKCQRGREQQEKEGKEGNSKKTMENVDSLDKLECRFKLNSYKMVYVIKSEDYMYRRT   1121 - 1190
ALLRAHQSHERVSKRLHQRFQAWVDKWTKEHVPREMAAETSKWLMGEGLEGLVPCTTTCDTETLHFVSIN   1191 - 1260
KYRVKYGTVFKAP                                                            1261 - 1273
//

Text Mined References (132)

PMID Year Title
26671595 2015 t(15;21) translocations leading to the concurrent downregulation of RUNX1 and its transcription factor partner genes SIN3A and TCF12 in myeloid disorders.
26118188 2015 Expression Analysis of p16, c-Myc, and mSin3A in Non-small Cell Lung Cancer by Computer Aided Scoring and Analysis (CASA).
25611699 2015 Down regulation of miR-202 modulates Mxd1 and Sin3A repressor complexes to induce apoptosis of pancreatic cancer cells.
25481483 2014 MiR-210 up-regulation inhibits proliferation and induces apoptosis in glioma cells by targeting SIN3A.
25395209 2015 SIN3A mutations are rare in men with azoospermia.
25314079 2014 Acetylation of snail modulates the cytokinome of cancer cells to enhance the recruitment of macrophages.
25305016 2014 SIN3A, generally regarded as a transcriptional repressor, is required for induction of gene transcription by the aryl hydrocarbon receptor.
24763403 2014 Sin3a-associated Hdac1 and Hdac2 are essential for hematopoietic stem cell homeostasis and contribute differentially to hematopoiesis.
24344258 2014 Epstein-Barr virus nuclear antigen 3C binds to BATF/IRF4 or SPI1/IRF4 composite sites and recruits Sin3A to repress CDKN2A.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...