Property Summary

NCBI Gene PubMed Count 17
Grant Count 2
R01 Count 2
Funding $119,757.7
PubMed Score 3.84
PubTator Score 7.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma -1.262 0.000
non primary Sjogren syndrome sicca 1.100 0.016
progressive supranuclear palsy -1.200 0.006
ovarian cancer 1.200 0.000

Synonym

Gene

PANTHER Protein Class (1)

 Grant Application (2)

Gene RIF (10)

PMID Text
26245978 common LEDGF/p75 interaction interface shared by JPO2, PogZ, MLL1, IWS1 and HIV IN
26245978 The IN catalytic core domain has a higher binding affinity (Kd) for PSIP1 (LEDGF/p75) than the physiological binding partner, IWS1
26245978 The IN catalytic core domain has a higher binding affinity (Kd) for PSIP1 (LEDGF/p75) than the physiological binding partner, IWS1
26245978 The IN catalytic core domain has a higher binding affinity (Kd) for PSIP1 (LEDGF/p75) than the physiological binding partner, IWS1
25590759 Altogether, these results indicate that a complex containing LEDGF/p75, Iws1, and Spt6 participates in regulating postintegration steps of HIV latency.
25590759 Knockdown of IWS1 by shRNA enhances HIV-1 replication in HIV-1-infected CD4+ T-cells and latently infected cells
24462114 IWS1, an RNA processing regulator, is phosphorylated by Akt3 and Akt1 at Ser720/Thr721 in lung cancer
19141475 recombinant Spt6 binds selectively to a stretch of uninterrupted consensus repeats located in the N-terminal half of the CTD and recruits Iws1
17234882 binding of Spt6 to Ser2-P RNAPII provides a cotranscriptional mechanism to recruit Iws1, REF1/Aly, and associated mRNA processing, surveillance, and export factors to responsive genes.
17184735 Here we report that the human homolog of Iws1, hIws1, physically interacts with protein arginine methyltransferases PRMT5 which methylates elongation factor Spt5 and regulates its interaction with RNA polymerase II.

AA Sequence

MDSEYYSGDQSDDGGATPVQDERDSGSDGEDDVNEQHSGSDTGSVERHSENETSDREDGLPKGHHVTDSE      1 - 70
NDEPLNLNASDSESEELHRQKDSDSESEERAEPPASDSENEDVNQHGSDSESEETRKLPGSDSENEELLN     71 - 140
GHASDSENEDVGKHPASDSEIEELQKSPASDSETEDALKPQISDSESEEPPRHQASDSENEEPPKPRMSD    141 - 210
SESEELPKPQVSDSESEEPPRHQASDSENEELPKPRISDSESEDPPRHQASDSENEELPKPRISDSESED    211 - 280
PPRNQASDSENEELPKPRVSDSESEGPQKGPASDSETEDASRHKQKPESDDDSDRENKGEDTEMQNDSFH    281 - 350
SDSHMDRKKFHSSDSEEEEHKKQKMDSDEDEKEGEEEKVAKRKAAVLSDSEDEEKASAKKSRVVSDADDS    351 - 420
DSDAVSDKSGKREKTIASDSEEEAGKELSDKKNEEKDLFGSDSESGNEEENLIADIFGESGDEEEEEFTG    421 - 490
FNQEDLEEEKGETQVKEAEDSDSDDNIKRGKHMDFLSDFEMMLQRKKSMSGKRRRNRDGGTFISDADDVV    491 - 560
SAMIVKMNEAAEEDRQLNNQKKPALKKLTLLPAVVMHLKKQDLKETFIDSGVMSAIKEWLSPLPDRSLPA    561 - 630
LKIREELLKILQELPSVSQETLKHSGIGRAVMYLYKHPKESRSNKDMAGKLINEWSRPIFGLTSNYKGMT    631 - 700
REEREQRDLEQMPQRRRMNSTGGQTPRRDLEKVLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKWNV    701 - 770
EMESSRFQATSKKGISRLDKQMRKFTDIRKKSRSAHAVKISIEGNKMPL                         771 - 819
//

Text Mined References (29)

PMID Year Title
26245978 2015 Multiple cellular proteins interact with LEDGF/p75 through a conserved unstructured consensus motif.
25689719 2015 HDGF-related protein-2 (HRP-2) acts as an oncogene to promote cell growth in hepatocellular carcinoma.
25590759 2015 The integrase cofactor LEDGF/p75 associates with Iws1 and Spt6 for postintegration silencing of HIV-1 gene expression in latently infected cells.
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
24462114 2014 Phosphoproteomics screen reveals akt isoform-specific signals linking RNA processing to lung cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...