Property Summary

NCBI Gene PubMed Count 17
PubMed Score 4.84
PubTator Score 7.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
osteosarcoma 7950 5.1e-06
ovarian cancer 8520 2.3e-04
progressive supranuclear palsy 676 5.6e-03
non primary Sjogren syndrome sicca 891 1.6e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Atrial heart septal defect 18 3.255 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.100 1.6e-02
osteosarcoma -1.262 5.1e-06
ovarian cancer 1.200 2.3e-04
progressive supranuclear palsy -1.200 5.6e-03

Gene RIF (8)

AA Sequence

MDSEYYSGDQSDDGGATPVQDERDSGSDGEDDVNEQHSGSDTGSVERHSENETSDREDGLPKGHHVTDSE      1 - 70
NDEPLNLNASDSESEELHRQKDSDSESEERAEPPASDSENEDVNQHGSDSESEETRKLPGSDSENEELLN     71 - 140
GHASDSENEDVGKHPASDSEIEELQKSPASDSETEDALKPQISDSESEEPPRHQASDSENEEPPKPRMSD    141 - 210
SESEELPKPQVSDSESEEPPRHQASDSENEELPKPRISDSESEDPPRHQASDSENEELPKPRISDSESED    211 - 280
PPRNQASDSENEELPKPRVSDSESEGPQKGPASDSETEDASRHKQKPESDDDSDRENKGEDTEMQNDSFH    281 - 350
SDSHMDRKKFHSSDSEEEEHKKQKMDSDEDEKEGEEEKVAKRKAAVLSDSEDEEKASAKKSRVVSDADDS    351 - 420
DSDAVSDKSGKREKTIASDSEEEAGKELSDKKNEEKDLFGSDSESGNEEENLIADIFGESGDEEEEEFTG    421 - 490
FNQEDLEEEKGETQVKEAEDSDSDDNIKRGKHMDFLSDFEMMLQRKKSMSGKRRRNRDGGTFISDADDVV    491 - 560
SAMIVKMNEAAEEDRQLNNQKKPALKKLTLLPAVVMHLKKQDLKETFIDSGVMSAIKEWLSPLPDRSLPA    561 - 630
LKIREELLKILQELPSVSQETLKHSGIGRAVMYLYKHPKESRSNKDMAGKLINEWSRPIFGLTSNYKGMT    631 - 700
REEREQRDLEQMPQRRRMNSTGGQTPRRDLEKVLTGEEKALRPGDPGFCARARVPMPSNKDYVVRPKWNV    701 - 770
EMESSRFQATSKKGISRLDKQMRKFTDIRKKSRSAHAVKISIEGNKMPL                         771 - 819
//

Text Mined References (29)

PMID Year Title