Property Summary

NCBI Gene PubMed Count 28
Grant Count 14
R01 Count 10
Funding $1,906,321.84
PubMed Score 25.55
PubTator Score 32.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
psoriasis 1.500 0.000
non-small cell lung cancer 1.791 0.000
intraductal papillary-mucinous adenoma (... 1.200 0.001
pancreatic cancer 1.500 0.002
ulcerative colitis -1.300 0.001

 MGI Term (1)

Gene RIF (17)

PMID Text
25557876 CYP2S1 regulates colorectal cancer growth through associated with prostaglandin E2-mediated activation of beta-catenin signaling.
23682735 The P450 2S1 may be involved in the reductive detoxication of several of the activated products of carcinogenic aromatic amines and heterocyclic aromatic amines.
23648403 NADPH-P450 reductase
23224081 found that CYP inhibition and siRNA-mediated downregulation of CYP2S1 increased macrophage phagocytosis
22863683 The reduction in CYP2S1 expression doubled intracellular PGE(2) levels.
22232929 No association has been found between the CYP2J2 (rs890293, -76G > T) or CYP2S1 (rs34971233, 13106C > T, P466L and rs338583, 13255A > G) gene polymorphisms and respiratory diseases.
22039172 Data suggest that CYP2S1 is induced in a keratinocyte cell line by exposure to all-trans retinoic acid and ultraviolet B radiation.
21430234 P450 2S1 can be reduced by NADPH-P450 reductase and suggest normal mixed-function oxidase roles of P450 2S1 to be revealed.
19713358 CYP2S1 contributes to the metabolism of environmental carcinogens via a nicotinamide adenine dinucleotide phosphate (NADPH)- independent activity.
19368491 Review compares the expression of CYP2S1 mRNA and protein in humans, mice and rats, and critically examines evidence pertaining to CYP2S1 regulation and its catalytic activity.
More...

AA Sequence

MEATGTWALLLALALLLLLTLALSGTRARGHLPPGPTPLPLLGNLLQLRPGALYSGLMRLSKKYGPVFTI      1 - 70
YLGPWRPVVVLVGQEAVREALGGQAEEFSGRGTVAMLEGTFDGHGVFFSNGERWRQLRKFTMLALRDLGM     71 - 140
GKREGEELIQAEARCLVETFQGTEGRPFDPSLLLAQATSNVVCSLLFGLRFSYEDKEFQAVVRAAGGTLL    141 - 210
GVSSQGGQTYEMFSWFLRPLPGPHKQLLHHVSTLAAFTVRQVQQHQGNLDASGPARDLVDAFLLKMAQEE    211 - 280
QNPGTEFTNKNMLMTVIYLLFAGTMTVSTTVGYTLLLLMKYPHVQKWVREELNRELGAGQAPSLGDRTRL    281 - 350
PYTDAVLHEAQRLLALVPMGIPRTLMRTTRFRGYTLPQGTEVFPLLGSILHDPNIFKHPEEFNPDRFLDA    351 - 420
DGRFRKHEAFLPFSLGKRVCLGEGLAKAELFLFFTTILQAFSLESPCPPDTLSLKPTVSGLFNIPPAFQL    421 - 490
QVRPTDLHSTTQTR                                                            491 - 504
//

Text Mined References (28)

PMID Year Title
25557876 2015 CYP2S1 depletion enhances colorectal cell proliferation is associated with PGE2-mediated activation of ?-catenin signaling.
25416956 2014 A proteome-scale map of the human interactome network.
24279958 2013 A transcriptomic approach to elucidate the physiological significance of human cytochrome P450 2S1 in bronchial epithelial cells.
23933117 2013 Differential gene expression in HIV-infected individuals following ART.
23682735 2013 Reduction of aromatic and heterocyclic aromatic N-hydroxylamines by human cytochrome P450 2S1.
23648403 2013 Biotransformation of (+)-fenchone by Salmonella typhimurium OY1002/2A6 expressing human CYP2A6 and NADPH-P450 reductase.
23224081 2013 Cytochrome P4502S1: a novel monocyte/macrophage fatty acid epoxygenase in human atherosclerotic plaques.
22863683 2012 Cytochrome P450 2S1 depletion enhances cell proliferation and migration in bronchial epithelial cells, in part, through modulation of prostaglandin E(2) synthesis.
22232929 2011 [Polymorphic markers of the CYP1B1 (4326C > G), CYP2F1 (c.14_15insC), CYP2J2 (-76G > T), and CYP2S1 (13106C > T and 13255A > G) genes and genetic predisposition to chronic respiratory diseases induced by smoking and occupational factors].
22039172 2012 Characterization of a human keratinocyte HaCaT cell line model to study the regulation of CYP2S1.
More...