Property Summary

NCBI Gene PubMed Count 12
PubMed Score 9.38
PubTator Score 7.16

Knowledge Summary


No data available


  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 4.75868863406667E-51
non-small cell lung cancer 2798 2.41249277730964E-25
lung adenocarcinoma 2714 4.65230315528241E-16
breast carcinoma 1614 1.15506935452865E-5
pilocytic astrocytoma 3086 9.96707817352077E-5
cystic fibrosis 1670 1.20013395617149E-4
ductal carcinoma in situ 1745 1.41123707512168E-4
interstitial cystitis 2299 4.13401830052698E-4
osteosarcoma 7933 4.33117645672656E-4
invasive ductal carcinoma 2950 9.96307998239216E-4
oligodendroglioma 2849 0.00426477762512819
fibroadenoma 557 0.0114489078277576
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0162456954906177
atypical teratoid / rhabdoid tumor 4369 0.0162878800396444
Breast cancer 3099 0.0280468531488129
Endometriosis 535 0.0367987276204456


  Differential Expression (16)

Disease log2 FC p
oligodendroglioma 3.200 0.004
osteosarcoma 1.027 0.000
atypical teratoid / rhabdoid tumor 1.100 0.016
pancreatic ductal adenocarcinoma liver m... -1.152 0.016
non-small cell lung cancer -2.477 0.000
breast carcinoma -1.400 0.000
fibroadenoma -1.200 0.011
Breast cancer -2.500 0.028
interstitial cystitis -1.500 0.000
cystic fibrosis -1.200 0.000
pilocytic astrocytoma 1.200 0.000
lung adenocarcinoma -3.200 0.000
Endometriosis -1.231 0.037
ductal carcinoma in situ -1.800 0.000
invasive ductal carcinoma -2.100 0.001
psoriasis -1.600 0.000


Accession Q96SQ7 Q504S2 Q659B0
Symbols HATH6


PANTHER Protein Class (2)

  Ortholog (5)

Species Source
Mouse OMA Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA Inparanoid

 MGI Term (1)

Pathway (1)

Gene RIF (5)

26099525 ATOH8 appears to be a tumor suppressor that induces stem-cell features and chemoresistance in HCC cells.
25514850 Regeneration marker ATOH8 contributes to muscle cell differentiation in healthy and diseased human muscle tissue.
21857980 Data show that in ATOH8 was hosted in one chromosome which is a fusion product of two orthologous chromosomes in non-human. primates.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

SLARLADLDYSADHSNLSFSECVQRCTRTLQAEGRAKKRKE                                 281 - 321

Text Mined References (15)

PMID Year Title
26099525 2015 Loss of ATOH8 Increases Stem Cell Features of Hepatocellular Carcinoma Cells.
25514850 2015 ATOH8: a novel marker in human muscle fiber regeneration.
24463812 2014 The role of Hath6, a newly identified shear-stress-responsive transcription factor, in endothelial cell differentiation and function.
24236640 2014 The transcription factor ATOH8 is regulated by erythropoietic activity and regulates HAMP transcription and cellular pSMAD1,5,8 levels.
21857980 2011 Diversification and molecular evolution of ATOH8, a gene encoding a bHLH transcription factor.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.