Property Summary

NCBI Gene PubMed Count 15
PubMed Score 12.27
PubTator Score 7.16

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Astrocytoma, Pilocytic 1.200 1.0e-04
atypical teratoid / rhabdoid tumor 1.100 1.6e-02
Breast cancer -2.500 2.8e-02
breast carcinoma -1.400 1.2e-05
cystic fibrosis -1.200 1.2e-04
ductal carcinoma in situ -1.800 1.4e-04
Endometriosis -1.231 3.7e-02
fibroadenoma -1.200 1.1e-02
interstitial cystitis -1.400 2.8e-03
invasive ductal carcinoma -2.100 1.0e-03
lung adenocarcinoma -3.200 4.7e-16
non-small cell lung cancer -2.477 2.4e-25
oligodendroglioma 3.200 4.3e-03
osteosarcoma 1.027 4.3e-04
pancreatic ductal adenocarcinoma liver m... -1.152 1.6e-02
psoriasis -1.600 4.8e-51

Gene RIF (8)

AA Sequence

MKHIPVLEDGPWKTVCVKELNGLKKLKRKGKEPARRANGYKTFRLDLEAPEPRAVATNGLRDRTHRLQPV      1 - 70
PVPVPVPVPVAPAVPPRGGTDTAGERGGSRAPEVSDARKRCFALGAVGPGLPTPPPPPPPAPQSQAPGGP     71 - 140
EAQPFREPGLRPRILLCAPPARPAPSAPPAPPAPPESTVRPAPPTRPGESSYSSISHVIYNNHQDSSASP    141 - 210
RKRPGEATAASSEIKALQQTRRLLANARERTRVHTISAAFEALRKQVPCYSYGQKLSKLAILRIACNYIL    211 - 280
SLARLADLDYSADHSNLSFSECVQRCTRTLQAEGRAKKRKE                                 281 - 321
//

Text Mined References (18)

PMID Year Title