Property Summary

NCBI Gene PubMed Count 49
Grant Count 6
R01 Count 6
Funding $285,415
PubMed Score 48.15
PubTator Score 92.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -2.188 0.000
acute quadriplegic myopathy 1.234 0.000
intraductal papillary-mucinous neoplasm ... 1.600 0.012
group 3 medulloblastoma 1.300 0.002
ovarian cancer 2.700 0.000

 GWAS Trait (1)

Gene RIF (24)

PMID Text
26987684 stabilization of the centrosome-spindle pole interface by the CEP215-HSET complex could promote survival of cancer cells containing supernumerary centrosomes.
26550838 mouse expresses only one form of CDK5RAP2 that is equivalent to the human and rat alternatively spliced variant forms
26485573 These results show that Cep169 targets microtubule tips and regulates stability of microtubules with CDK5RAP2.
26192437 LRRK1 regulates mitotic spindle orientation downstream of PLK1 through CDK5RAP2-dependent centrosome maturation.
25503564 Cep68 degradation allows Cep215 removal from peripheral pericentriolar material (PCM) preventing centriole separation following disengagement, PCNT cleavage mediates Cep215 removal from core of the PCM to inhibit centriole disengagement and duplication
24782177 DPP4, CDK5RAP2, and CCR6 are risk loci for rheumatoid arthritis in Han Chinese and congruence with risk variants in Europeans.
24466316 The CEP215-pericentrin interaction is required for centrosome maturation and subsequent bipolar spindle formation during mitosis.
23874654 results reveal a key role of the dynein-dynactin complex in the dynamic recruitment of CDK5RAP2 to centrosomes
23587236 Sequencing of the coding exons and exon/intron splice junctions of the CDK5RAP2 gene identified homozygosity for the novel nonsense mutation, c.4441C > T (p.Arg1481*), in both affected sons
22806269 Human expression pattern of CDK5RAP2 is similar to that seen in mice and is in concordance with pathology suggested by neuroimaging studies in humans and mouse
More...

AA Sequence

MMDLVLEEDVTVPGTLSGCSGLVPSVPDDLDGINPNAGLGNGLLPNVSEETVSPTRARNMKDFENQITEL      1 - 70
KKENFNLKLRIYFLEERMQQEFHGPTEHIYKTNIELKVEVESLKRELQEREQLLIKASKAVESLAEAGGS     71 - 140
EIQRVKEDARKKVQQVEDLLTKRILLLEKDVTAAQAELEKAFAGTETEKALRLRLESKLSEMKKMHEGDL    141 - 210
AMALVLDEKDRLIEELKLSLKSKEALIQCLKEEKSQMACPDENVSSGELRGLCAAPREEKERETEAAQME    211 - 280
HQKERNSFEERIQALEEDLREKEREIATEKKNSLKRDKAIQGLTMALKSKEKKVEELNSEIEKLSAAFAK    281 - 350
AREALQKAQTQEFQGSEDYETALSGKEALSAALRSQNLTKSTENHRLRRSIKKITQELSDLQQERERLEK    351 - 420
DLEEAHREKSKGDCTIRDLRNEVEKLRNEVNEREKAMENRYKSLLSESNKKLHNQEQVIKHLTESTNQKD    421 - 490
VLLQKFNEKDLEVIQQNCYLMAAEDLELRSEGLITEKCSSQQPPGSKTIFSKEKKQSSDYEELIQVLKKE    491 - 560
QDIYTHLVKSLQESDSINNLQAELNKIFALRKQLEQDVLSYQNLRKTLEEQISEIRRREEESFSLYSDQT    561 - 630
SYLSICLEENNRFQVEHFSQEELKKKVSDLIQLVKELYTDNQHLKKTIFDLSCMGFQGNGFPDRLASTEQ    631 - 700
TELLASKEDEDTIKIGEDDEINFLSDQHLQQSNEIMKDLSKGGCKNGYLRHTESKISDCDGAHAPGCLEE    701 - 770
GAFINLLAPLFNEKATLLLESRPDLLKVVRELLLGQLFLTEQEVSGEHLDGKTEKTPKQKGELVHFVQTN    771 - 840
SFSKPHDELKLSCEAQLVKAGEVPKVGLKDASVQTVATEGDLLRFKHEATREAWEEKPINTALSAEHRPE    841 - 910
NLHGVPGWQAALLSLPGITNREAKKSRLPILIKPSRSLGNMYRLPATQEVVTQLQSQILELQGELKEFKT    911 - 980
CNKQLHQKLILAEAVMEGRPTPDKTLLNAQPPVGAAYQDSPGEQKGIKTTSSVWRDKEMDSDQQRSYEID    981 - 1050
SEICPPDDLASLPSCKENPEDVLSPTSVATYLSSKSQPSAKVSVMGTDQSESINTSNETEYLKQKIHDLE   1051 - 1120
TELEGYQNFIFQLQKHSQCSEAIITVLCGTEGAQDGLSKPKNGSDGEEMTFSSLHQVRYVKHVKILGPLA   1121 - 1190
PEMIDSRVLENLKQQLEEQEYKLQKEQNLNMQLFSEIHNLQNKFRDLSPPRYDSLVQSQARELSLQRQQI   1191 - 1260
KDGHGICVISRQHMNTMIKAFEELLQASDVDYCVAEGFQEQLNQCAELLEKLEKLFLNGKSVGVEMNTQN   1261 - 1330
ELMERIEEDNLTYQHLLPESPEPSASHALSDYETSEKSFFSRDQKQDNETEKTSVMVNSFSQDLLMEHIQ   1331 - 1400
EIRTLRKRLEESIKTNEKLRKQLERQGSEFVQGSTSIFASGSELHSSLTSEIHFLRKQNQALNAMLIKGS   1401 - 1470
RDKQKENDKLRESLSRKTVSLEHLQREYASVKEENERLQKEGSEKERHNQQLIQEVRCSGQELSRVQEEV   1471 - 1540
KLRQQLLSQNDKLLQSLRVELKAYEKLDEEHRRLREASGEGWKGQDPFRDLHSLLMEIQALRLQLERSIE   1541 - 1610
TSSTLQSRLKEQLARGAEKAQEGALTLAVQAVSIPEVPLQPDKHDGDKYPMESDNSFDLFDSSQAVTPKS   1611 - 1680
VSETPPLSGNDTDSLSCDSGSSATSTPCVSRLVTGHHLWASKNGRHVLGLIEDYEALLKQISQGQRLLAE   1681 - 1750
MDIQTQEAPSSTSQELGTKGPHPAPLSKFVSSVSTAKLTLEEAYRRLKLLWRVSLPEDGQCPLHCEQIGE   1751 - 1820
MKAEVTKLHKKLFEQEKKLQNTMKLLQLSKRQEKVIFDQLVVTHKILRKARGNLELRPGGAHPGTCSPSR   1821 - 1890
PGS                                                                      1891 - 1893
//

Text Mined References (55)

PMID Year Title
26987684 2016 A CEP215-HSET complex links centrosomes with spindle poles and drives centrosome clustering in cancer.
26550838 2015 Species-Specific Expression of Full-Length and Alternatively Spliced Variant Forms of CDK5RAP2.
26485573 2015 Cep169, a Novel Microtubule Plus-End-Tracking Centrosomal Protein, Binds to CDK5RAP2 and Regulates Microtubule Stability.
26482847 2015 Microtubule-bundling activity of the centrosomal protein, Cep169, and its binding to microtubules.
26297806 2015 Centriolar satellites assemble centrosomal microcephaly proteins to recruit CDK2 and promote centriole duplication.
26192437 2015 PLK1-dependent activation of LRRK1 regulates spindle orientation by phosphorylating CDK5RAP2.
25503564 2015 Degradation of Cep68 and PCNT cleavage mediate Cep215 removal from the PCM to allow centriole separation, disengagement and licensing.
24782177 2014 Novel risk loci for rheumatoid arthritis in Han Chinese and congruence with risk variants in Europeans.
24466316 2014 Importance of the CEP215-pericentrin interaction for centrosome maturation during mitosis.
23874654 2013 Dynamic recruitment of CDK5RAP2 to centrosomes requires its association with dynein.
More...