Property Summary

NCBI Gene PubMed Count 21
Grant Count 19
R01 Count 15
Funding $1,529,552.11
PubMed Score 11.20
PubTator Score 13.07

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytic glioma 1.400 0.008
ependymoma 1.500 0.010
oligodendroglioma 1.200 0.010
psoriasis -1.700 0.001
osteosarcoma -2.467 0.000
atypical teratoid / rhabdoid tumor -1.100 0.013
glioblastoma 1.700 0.000
medulloblastoma, large-cell -1.800 0.007
interstitial cystitis 1.800 0.001
pediatric high grade glioma 1.100 0.001
group 4 medulloblastoma 1.100 0.016
Pick disease 1.500 0.000
progressive supranuclear palsy 1.200 0.003
ulcerative colitis 1.200 0.000
ovarian cancer -2.200 0.000

Gene RIF (9)

PMID Text
25769459 Orai1, Orai2 and STIM1 form functional Ca(2+) release-activated Ca(2+) channels in OUMS-27 cells (chondrocytes) and that these complexes are responsible for sustained Ca(2+) entry in response to agonist stimulation.
24603752 The higher amplitude of store-operated Ca2+ entry was associated to the over-expression for Stim2, Orai2-3, and TRPC1 while Stim2 levels remained constant and Stim1, Orai1, Orai3, TRPC1 and TRPC4 proteins were over-expressed in primary myelofibrosis.
24040356 Orai1 but not Orai2 plays a major role in the influx of extracellular Ca2+ into and mediator release from HLMCs following their activation
22640869 Orai1 and Orai2 operate in a STIM-dependent manner, Orai3 does not interact with STIM isoforms upon calcium store depletion in platelets.
20607548 With these data we show a new Ca(2)(+) entry pathway linked to the Ca(2)(+)/inositolphosphate second-messenger system in RPE cells which help to further understand regulatory pathways of agonists.
19706554 Data show that the fast Ca(2+)-dependent inactivation is mediated by three conserved glutamates in the C termini (CT) of Orai2 and Orai3, which show prominent fast Ca(2+)-dependent inactivation compared with Orai1.
19506081 analysis of activation of Orai1-3 channels by a STIM1 coiled-coil mutant
18403424 The effects of 2-aminoethoxydiphenyl borate on orai1, orai2, orai3 metabolism in HEK293 cells with and without STIM1 are reported.
17452328 Results suggest that Orai1, -2, and -3 channels are similarly inhibited by extracellular calcium, indicating similar affinities for Ca(2+) within the selectivity filter.

AA Sequence

MSAELNVPIDPSAPACPEPGHKGMDYRDWVRRSYLELVTSNHHSVQALSWRKLYLSRAKLKASSRTSALL      1 - 70
SGFAMVAMVEVQLETQYQYPRPLLIAFSACTTVLVAVHLFALLISTCILPNVEAVSNIHNLNSISESPHE     71 - 140
RMHPYIELAWGFSTVLGILLFLAEVVLLCWIKFLPVDARRQPGPPPGPGSHTGWQAALVSTIIMVPVGLI    141 - 210
FVVFTIHFYRSLVRHKTERHNREIEELHKLKVQLDGHERSLQVL                              211 - 254
//

Text Mined References (21)

PMID Year Title
25769459 2015 Orai1-Orai2 complex is involved in store-operated calcium entry in chondrocyte cell lines.
24603752 2014 Enhanced expression of Stim, Orai, and TRPC transcripts and proteins in endothelial progenitor cells isolated from patients with primary myelofibrosis.
24040356 2013 The contribution of Orai(CRACM)1 and Orai(CRACM)2 channels in store-operated Ca2+ entry and mediator release in human lung mast cells.
23890118 2013 The neglected CRAC proteins: Orai2, Orai3, and STIM2.
22640869 2012 Capacitative and non-capacitative signaling complexes in human platelets.
20607548 2011 Expression of Orai genes and I(CRAC) activation in the human retinal pigment epithelium.
20418871 2010 A novel EF-hand protein, CRACR2A, is a cytosolic Ca2+ sensor that stabilizes CRAC channels in T cells.
19706554 2009 Molecular determinants of fast Ca2+-dependent inactivation and gating of the Orai channels.
19506081 2009 Molecular determinants of the coupling between STIM1 and Orai channels: differential activation of Orai1-3 channels by a STIM1 coiled-coil mutant.
18403424 2008 2-Aminoethoxydiphenyl borate directly facilitates and indirectly inhibits STIM1-dependent gating of CRAC channels.
More...