Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.70
PubTator Score 2.29

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
sonic hedgehog group medulloblastoma 1482 8.59803512947112E-10
ovarian cancer 8492 1.25174008337673E-7
adult high grade glioma 2148 1.51871491317728E-7
glioblastoma 5572 1.72845355033431E-7
posterior fossa group A ependymoma 1511 5.34735783965897E-7
non-small cell lung cancer 2798 1.67432588410779E-6
atypical teratoid / rhabdoid tumor 4369 6.61741064484061E-5
pilocytic astrocytoma 3086 2.27808238735024E-4
interstitial cystitis 2299 8.13028835659796E-4
astrocytic glioma 2241 0.0012463865601126
cystic fibrosis 1670 0.00216770749552056
medulloblastoma, large-cell 6234 0.00305704183804674
primitive neuroectodermal tumor 3031 0.00357669629333226
oligodendroglioma 2849 0.0107531218491311
invasive ductal carcinoma 2950 0.0126978275523429
chronic rhinosinusitis 512 0.0283670984711507
interstitial lung disease 292 0.0334049856362266
Disease Target Count Z-score Confidence
Rheumatoid Arthritis 1171 0.0 2.0
Disease Target Count Z-score Confidence
Simpson-Golabi-Behmel syndrome 17 4.115 2.1
Lymphedema 26 3.255 1.6

Expression

Synonym

Accession Q96SM3 Q6P4G8 Q6UW65 Q9NUB5
Symbols CPX1
CPXM

Gene

PANTHER Protein Class (3)

  Ortholog (11)

Gene RIF (1)

PMID Text
10073577 This paper deals with mouse CPXM.

AA Sequence

MWGLLLALAAFAPAVGPALGAPRNSVLGLAQPGTTKVPGSTPALHSSPAQPPAETANGTSEQHVRIRVIK      1 - 70
KKKVIMKKRKKLTLTRPTPLVTAGPLVTPTPAGTLDPAEKQETGCPPLGLESLRVSDSRLEASSSQSFGL     71 - 140
GPHRGRLNIQSGLEDGDLYDGAWCAEEQDADPWFQVDAGHPTRFSGVITQGRNSVWRYDWVTSYKVQFSN    141 - 210
DSRTWWGSRNHSSGMDAVFPANSDPETPVLNLLPEPQVARFIRLLPQTWLQGGAPCLRAEILACPVSDPN    211 - 280
DLFLEAPASGSSDPLDFQHHNYKAMRKLMKQVQEQCPNITRIYSIGKSYQGLKLYVMEMSDKPGEHELGE    281 - 350
PEVRYVAGMHGNEALGRELLLLLMQFLCHEFLRGNPRVTRLLSEMRIHLLPSMNPDGYEIAYHRGSELVG    351 - 420
WAEGRWNNQSIDLNHNFADLNTPLWEAQDDGKVPHIVPNHHLPLPTYYTLPNATVAPETRAVIKWMKRIP    421 - 490
FVLSANLHGGELVVSYPFDMTRTPWAARELTPTPDDAVFRWLSTVYAGSNLAMQDTSRRPCHSQDFSVHG    491 - 560
NIINGADWHTVPGSMNDFSYLHTNCFEVTVELSCDKFPHENELPQEWENNKDALLTYLEQVRMGIAGVVR    561 - 630
DKDTELGIADAVIAVDGINHDVTTAWGGDYWRLLTPGDYMVTASAEGYHSVTRNCRVTFEEGPFPCNFVL    631 - 700
TKTPKQRLRELLAAGAKVPPDLRRRLERLRGQKD                                        701 - 734
//

Text Mined References (10)

PMID Year Title
26603934 2015 Carboxypeptidase X-1 (CPX-1) is a secreted collagen-binding glycoprotein.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
14759258 2004 An unappreciated role for RNA surveillance.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11780052 2001 The DNA sequence and comparative analysis of human chromosome 20.
10073577 1999 Identification of mouse CPX-1, a novel member of the metallocarboxypeptidase gene family with highest similarity to CPX-2.