Property Summary

NCBI Gene PubMed Count 11
PubMed Score 2.75
PubTator Score 2.29

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma 2.200 1.5e-07
astrocytic glioma 1.300 1.2e-03
Astrocytoma, Pilocytic 1.700 2.8e-04
atypical teratoid / rhabdoid tumor 1.700 6.6e-05
chronic rhinosinusitis -1.261 2.8e-02
cystic fibrosis 1.186 2.2e-03
ependymoma 1.500 1.9e-04
glioblastoma 2.600 1.7e-07
group 3 medulloblastoma 2.000 4.6e-04
interstitial cystitis 1.900 8.1e-04
interstitial lung disease 1.500 3.3e-02
invasive ductal carcinoma -1.100 1.3e-02
medulloblastoma, large-cell 2.000 3.1e-03
non-small cell lung cancer 1.227 1.7e-06
oligodendroglioma 1.900 1.1e-02
ovarian cancer -3.200 1.3e-07
primitive neuroectodermal tumor 2.400 3.6e-03

Gene RIF (2)

AA Sequence

MWGLLLALAAFAPAVGPALGAPRNSVLGLAQPGTTKVPGSTPALHSSPAQPPAETANGTSEQHVRIRVIK      1 - 70
KKKVIMKKRKKLTLTRPTPLVTAGPLVTPTPAGTLDPAEKQETGCPPLGLESLRVSDSRLEASSSQSFGL     71 - 140
GPHRGRLNIQSGLEDGDLYDGAWCAEEQDADPWFQVDAGHPTRFSGVITQGRNSVWRYDWVTSYKVQFSN    141 - 210
DSRTWWGSRNHSSGMDAVFPANSDPETPVLNLLPEPQVARFIRLLPQTWLQGGAPCLRAEILACPVSDPN    211 - 280
DLFLEAPASGSSDPLDFQHHNYKAMRKLMKQVQEQCPNITRIYSIGKSYQGLKLYVMEMSDKPGEHELGE    281 - 350
PEVRYVAGMHGNEALGRELLLLLMQFLCHEFLRGNPRVTRLLSEMRIHLLPSMNPDGYEIAYHRGSELVG    351 - 420
WAEGRWNNQSIDLNHNFADLNTPLWEAQDDGKVPHIVPNHHLPLPTYYTLPNATVAPETRAVIKWMKRIP    421 - 490
FVLSANLHGGELVVSYPFDMTRTPWAARELTPTPDDAVFRWLSTVYAGSNLAMQDTSRRPCHSQDFSVHG    491 - 560
NIINGADWHTVPGSMNDFSYLHTNCFEVTVELSCDKFPHENELPQEWENNKDALLTYLEQVRMGIAGVVR    561 - 630
DKDTELGIADAVIAVDGINHDVTTAWGGDYWRLLTPGDYMVTASAEGYHSVTRNCRVTFEEGPFPCNFVL    631 - 700
TKTPKQRLRELLAAGAKVPPDLRRRLERLRGQKD                                        701 - 734
//

Text Mined References (11)

PMID Year Title