Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.70
PubTator Score 1.02

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.400 4.2e-08
glioblastoma 1.300 5.7e-08
group 4 medulloblastoma 1.100 1.1e-04
medulloblastoma, large-cell 1.400 2.6e-06
osteosarcoma 1.919 6.0e-08
ovarian cancer 1.100 1.4e-08

Gene RIF (3)

AA Sequence

MDDVPAPTPAPAPPAAAAPRVPFHCSECGKSFRYRSDLRRHFARHTALKPHACPRCGKGFKHSFNLANHL      1 - 70
RSHTGERPYRCSACPKGFRDSTGLLHHQVVHTGEKPYCCLVCELRFSSRSSLGRHLKRQHRGVLPSPLQP     71 - 140
GPGLPALSAPCSVCCNVGPCSVCGGSGAGGGEGPEGAGAGLGSWGLAEAAAAAAASLPPFACGACARRFD    141 - 210
HGRELAAHWAAHTDVKPFKCPRCERDFNAPALLERHKLTHDLQGPGAPPAQAWAAGPGAGPETAGEGTAA    211 - 280
EAGDAPLASDRRLLLGPAGGGVPKLGGLLPEGGGEAPAPAAAAEPSEDTLYQCDCGTFFASAAALASHLE    281 - 350
AHSGPATYGCGHCGALYAALAALEEHRRVSHGEGGGEEAATAAREREPASGEPPSGSGRGKKIFGCSECE    351 - 420
KLFRSPRDLERHVLVHTGEKPFPCLECGKFFRHECYLKRHRLLHGTERPFPCHICGKGFITLSNLSRHLK    421 - 490
LHRGMD                                                                    491 - 496
//

Text Mined References (10)

PMID Year Title