Property Summary

NCBI Gene PubMed Count 7
Grant Count 5
R01 Count 5
Funding $227,309
PubMed Score 2.70
PubTator Score 1.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma 1.919 0.000
atypical teratoid / rhabdoid tumor 1.400 0.000
glioblastoma 1.300 0.000
medulloblastoma, large-cell 1.400 0.000
group 4 medulloblastoma 1.100 0.000
ovarian cancer 1.100 0.000

Gene RIF (3)

PMID Text
24956037 Signal transducer/transcription factor FIZ1 regulated signaling pathways are implicated in regulation of the balance between proliferation and differentiation in keratinocytes.
17141759 Activators of the Rhodopsin gene are present before activation of the gene. FIZ1 expression rises at this time and it can synergize with NRL and CRX at the Rho and PDE6B promoters. FIZ1 may syncronize the onset of maturation related gene expression.
12566383 Homologous to mouse and bovine Fiz1 (flt-3 interacting zinc finger). Interacts with NRL (neural retina leucine zipper). Antibody detects protein in human, mouse, bovine retina. Possible role for Fiz1 as a transcriptional repressor.

AA Sequence

MDDVPAPTPAPAPPAAAAPRVPFHCSECGKSFRYRSDLRRHFARHTALKPHACPRCGKGFKHSFNLANHL      1 - 70
RSHTGERPYRCSACPKGFRDSTGLLHHQVVHTGEKPYCCLVCELRFSSRSSLGRHLKRQHRGVLPSPLQP     71 - 140
GPGLPALSAPCSVCCNVGPCSVCGGSGAGGGEGPEGAGAGLGSWGLAEAAAAAAASLPPFACGACARRFD    141 - 210
HGRELAAHWAAHTDVKPFKCPRCERDFNAPALLERHKLTHDLQGPGAPPAQAWAAGPGAGPETAGEGTAA    211 - 280
EAGDAPLASDRRLLLGPAGGGVPKLGGLLPEGGGEAPAPAAAAEPSEDTLYQCDCGTFFASAAALASHLE    281 - 350
AHSGPATYGCGHCGALYAALAALEEHRRVSHGEGGGEEAATAAREREPASGEPPSGSGRGKKIFGCSECE    351 - 420
KLFRSPRDLERHVLVHTGEKPFPCLECGKFFRHECYLKRHRLLHGTERPFPCHICGKGFITLSNLSRHLK    421 - 490
LHRGMD                                                                    491 - 496
//

Text Mined References (10)

PMID Year Title
24956037 2014 Dissection of a novel autocrine signaling pathway via quantitative secretome and interactome mapping.
24024966 2013 Genome-wide association study of chronic periodontitis in a general German population.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
17141759 2007 FIZ1 is expressed during photoreceptor maturation, and synergizes with NRL and CRX at rod-specific promoters in vitro.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12566383 2003 Interaction of retinal bZIP transcription factor NRL with Flt3-interacting zinc-finger protein Fiz1: possible role of Fiz1 as a transcriptional repressor.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10409713 1999 Fiz1, a novel zinc finger protein interacting with the receptor tyrosine kinase Flt3.