Property Summary

NCBI Gene PubMed Count 23
Grant Count 5
R01 Count 5
Funding $1,631,298
PubMed Score 27.28
PubTator Score 13.45

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96SL4 O95337 Q5T501 GPx-7
Symbols GPX6
CL683
GPx-7
NPGPx
GSHPx-7

Gene

PANTHER Protein Class (2)

PDB

2P31  

Gene RIF (18)

PMID Text
26708178 use GPX4 and GPX7 as possible markers for improving HCC diagnosis/prognosis.
25586538 SNPs most associated with Chemotherapy-induced peripheral neuropathy were in ATP-binding cassette sub-family C member 4 (ABCC4) gene.
24692067 Loss of glutathione peroxidase 7 promotes TNF-alpha-induced NF-kappaB activation in Barrett's carcinogenesis.
23919619 GPx7 promotes oxidative protein folding, directly utilizing Ero1alpha-generated hydrogen peroxide in the early secretory compartment.
23828861 NPGPx protects against fat accumulation in mice and human via modulating ROS
23580780 tumour suppressor functions in esophageal adenocarcinomas and silenced by location-specific promoter DNA methylation
23454490 GPx7 is an unusual CysGPx catalyzing the peroxidatic cycle by a one Cys mechanism in which GSH and PDI are alternative substrates.
23123197 NPGPx is essential for releasing excessive ER stress by enhancing GRP78 chaperone activity to maintain physiological homeostasis.
21215271 GPx7 labeled as secreted glutathione peroxidase, is actually endoplasmic reticulum-resident protein disulfide isomerase peroxidase
20819778 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
More...

AA Sequence

MVAATVAAAWLLLWAAACAQQEQDFYDFKAVNIRGKLVSLEKYRGSVSLVVNVASECGFTDQHYRALQQL      1 - 70
QRDLGPHHFNVLAFPCNQFGQQEPDSNKEIESFARRTYSVSFPMFSKIAVTGTGAHPAFKYLAQTSGKEP     71 - 140
TWNFWKYLVAPDGKVVGAWDPTVSVEEVRPQITALVRKLILLKREDL                           141 - 187
//

Text Mined References (23)

PMID Year Title
26708178 2015 GPX4 and GPX7 over-expression in human hepatocellular carcinoma tissues.
25586538 2015 Candidate pathway-based genetic association study of platinum and platinum-taxane related toxicity in a cohort of primary lung cancer patients.
25416956 2014 A proteome-scale map of the human interactome network.
24692067 2014 Loss of glutathione peroxidase 7 promotes TNF-?-induced NF-?B activation in Barrett's carcinogenesis.
23919619 2014 Glutathione peroxidase 7 utilizes hydrogen peroxide generated by Ero1? to promote oxidative protein folding.
23828861 2013 Deficiency of NPGPx, an oxidative stress sensor, leads to obesity in mice and human.
23580780 2014 Glutathione peroxidase 7 has potential tumour suppressor functions that are silenced by location-specific methylation in oesophageal adenocarcinoma.
23454490 2013 Protein disulfide isomerase and glutathione are alternative substrates in the one Cys catalytic cycle of glutathione peroxidase 7.
23123197 2012 Loss of the oxidative stress sensor NPGPx compromises GRP78 chaperone activity and induces systemic disease.
22157330 2012 Glutathione peroxidase 7 protects against oxidative DNA damage in oesophageal cells.
More...