Property Summary

NCBI Gene PubMed Count 8
PubMed Score 38.23
PubTator Score 49.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma, Renal Cell 124 0.0 0.0
Disease Target Count
Renal Cell Carcinoma 214
Disease Target Count P-value
ovarian cancer 8520 1.0e-04
tuberculosis 2010 2.2e-04
active ulcerative colitis 764 1.3e-02
spina bifida 1074 4.0e-02
Disease Target Count Z-score Confidence
Seminal vesicle tumor 3 4.083 2.0
Disease Target Count
Renal Cell Carcinoma, Nonpapillary 7

Expression

  Differential Expression (4)

Disease log2 FC p
active ulcerative colitis 1.174 1.3e-02
ovarian cancer 1.300 1.0e-04
spina bifida -1.821 4.0e-02
tuberculosis -1.300 2.2e-04

Gene RIF (2)

AA Sequence

MGSRWSSEEERQPLLGPGLGPGLGASWRSREAAAAALPAAVPGPGRVYGRRWLVLLLFSLLAFVQGLVWN      1 - 70
TWGPIQNSARQAYGFSSWDIALLVLWGPIGFLPCFAFMWLLDKRGLRITVLLTSFLMVLGTGLRCIPISD     71 - 140
LILKRRLIHGGQMLNGLAGPTVMNAAPFLSTTWFSADERATATAIASMLSYLGGACAFLVGPLVVPAPNG    141 - 210
TSPLLAAESSRAHIKDRIEAVLYAEFGVVCLIFSATLAYFPPRPPLPPSVAAASQRLSYRRSVCRLLSNF    211 - 280
RFLMIALAYAIPLGVFAGWSGVLDLILTPAHVSQVDAGWIGFWSIVGGCVVGIAMARFADFIRGMLKLIL    281 - 350
LLLFSGATLSSTWFTLTCLNSITHLPLTTVTLYASCILLGVFLNSSVPIFFELFVETVYPVPEGITCGVV    351 - 420
TFLSNMFMGVLLFFLTFYHTELSWFNWCLPGSCLLSLLLILCFRESYDRLYLDVVVSV                421 - 478
//

Text Mined References (8)

PMID Year Title