Property Summary

NCBI Gene PubMed Count 14
PubMed Score 7.01
PubTator Score 4.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.900 3.7e-04
ependymoma 1.400 9.9e-05
glioblastoma 1.500 3.7e-02
intraductal papillary-mucinous adenoma (... -1.100 7.2e-04
invasive ductal carcinoma -1.300 6.8e-03
lung adenocarcinoma -1.400 7.1e-15
lung carcinoma -1.200 5.0e-07
medulloblastoma 1.800 3.1e-03
medulloblastoma, large-cell 1.700 1.9e-02
non-small cell lung carcinoma -1.300 7.4e-20
primitive neuroectodermal tumor 2.700 2.6e-04

Gene RIF (7)

AA Sequence

MEGDCLSCMKYLMFVFNFFIFLGGACLLAIGIWVMVDPTGFREIVAANPLLLTGAYILLAMGGLLFLLGF      1 - 70
LGCCGAVRENKCLLLFFFLFILIIFLAELSAAILAFIFRENLTREFFTKELTKHYQGNNDTDVFSATWNS     71 - 140
VMITFGCCGVNGPEDFKFASVFRLLTLDSEEVPEACCRREPQSRDGVLLSREECLLGRSLFLNKQGCYTV    141 - 210
ILNTFETYVYLAGALAIGVLAIELFAMIFAMCLFRGIQ                                    211 - 248
//

Text Mined References (14)

PMID Year Title