Property Summary

NCBI Gene PubMed Count 12
PubMed Score 7.78
PubTator Score 4.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
non-small cell lung carcinoma 413 7.37599355330497E-20
lung adenocarcinoma 2714 7.12059816189334E-15
lung carcinoma 2844 5.02057129003241E-7
posterior fossa group A ependymoma 1511 1.14968434905499E-6
sonic hedgehog group medulloblastoma 1482 2.4216883455896E-6
primitive neuroectodermal tumor 3031 2.64238717688545E-4
atypical teratoid / rhabdoid tumor 4369 3.67592744365606E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 7.23491517010056E-4
invasive ductal carcinoma 2950 0.00677083229754804
medulloblastoma, large-cell 6234 0.0188027747623829
glioblastoma 5572 0.0368797020695825
Disease Target Count Z-score Confidence
Schizophrenia 503 3.34 1.7
ulcerative colitis 2087 0.0 2.0
Disease Target Count Z-score Confidence
Barrett's esophagus 185 3.657 1.8

Expression

Synonym

Accession Q96SJ8 Q6UY44 Q8NBI9 Tspan-18
Symbols TSPAN

Gene

  Ortholog (12)

 GWAS Trait (1)

Pathway (1)

Gene RIF (5)

PMID Text
26016498 Meta-analysis results show no significant association between TSPAN18 gene and schizophrenia in the Han Chinese population indicating the gene is unlikely to be a major susceptibility gene for schizophrenia in this population.
23505562 These results confirm the significant association, in Han Chinese populations, of increased SCZ risk and the variant of the TSPAN18 gene containing the 'A' allele of SNP rs835784.
22632162 FITC-labeled Tat 47-59 peptide downregulates gene expression of tetraspanin 18 (TSPAN18) in U-937 macrophages
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19240061 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MEGDCLSCMKYLMFVFNFFIFLGGACLLAIGIWVMVDPTGFREIVAANPLLLTGAYILLAMGGLLFLLGF      1 - 70
LGCCGAVRENKCLLLFFFLFILIIFLAELSAAILAFIFRENLTREFFTKELTKHYQGNNDTDVFSATWNS     71 - 140
VMITFGCCGVNGPEDFKFASVFRLLTLDSEEVPEACCRREPQSRDGVLLSREECLLGRSLFLNKQGCYTV    141 - 210
ILNTFETYVYLAGALAIGVLAIELFAMIFAMCLFRGIQ                                    211 - 248
//

Text Mined References (12)

PMID Year Title
26016498 2015 Lack of Association between the TSPAN18 Gene and Schizophrenia Based on New Data from Han Chinese and a Meta-Analysis.
23505562 2013 Replication study confirms link between TSPAN18 mutation and schizophrenia in Han Chinese.
22037552 2011 Genome-wide association study identifies a susceptibility locus for schizophrenia in Han Chinese at 11p11.2.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19240061 2009 Coeliac disease-associated risk variants in TNFAIP3 and REL implicate altered NF-kappaB signalling.
17192395 2007 Comparative gene expression profiling of in vitro differentiated megakaryocytes and erythroblasts identifies novel activatory and inhibitory platelet membrane proteins.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...