Property Summary

NCBI Gene PubMed Count 20
PubMed Score 68.44
PubTator Score 46.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (24)

Disease log2 FC p
adult high grade glioma -1.600 2.4e-04
astrocytic glioma -1.100 4.1e-02
Astrocytoma, Pilocytic -1.600 8.5e-08
atypical teratoid / rhabdoid tumor -2.100 1.3e-05
Breast cancer 3.100 3.2e-02
ductal carcinoma in situ 1.300 1.7e-03
Endometriosis -1.055 2.2e-02
ependymoma -1.600 6.7e-07
glioblastoma -1.100 6.3e-04
group 4 medulloblastoma -1.300 7.3e-03
intraductal papillary-mucinous adenoma (... 1.800 7.8e-04
intraductal papillary-mucinous carcinoma... 1.900 5.0e-04
intraductal papillary-mucinous neoplasm ... 1.100 1.4e-03
invasive ductal carcinoma 1.700 7.7e-03
medulloblastoma, large-cell -1.200 7.9e-03
nasopharyngeal carcinoma -1.200 2.6e-03
non-small cell lung cancer 1.132 8.0e-11
osteosarcoma -2.246 9.3e-04
ovarian cancer -2.100 1.2e-05
pituitary cancer -1.300 1.4e-03
primitive neuroectodermal tumor -1.400 2.8e-03
progressive supranuclear palsy 1.200 2.9e-02
spina bifida -1.233 3.7e-02
subependymal giant cell astrocytoma -1.097 4.6e-02

Gene RIF (1)

AA Sequence

MRSIRSFANDDRHVMVKHSTIYPSPEELEAVQNMVSTVECALKHVSDWLDETNKGTKTEGETEVKKDEAG      1 - 70
ENYSKDQGGRTLCGVMRIGLVAKGLLIKDDMDLELVLMCKDKPTETLLNTVKDNLPIQIQKLTEEKYQVE     71 - 140
QCVNEASIIIRNTKEPTLTLKVILTSPLIRDELEKKDGENVSMKDPPDLLDRQKCLNALASLRHAKWFQA    141 - 210
RANGLKSCVIVLRILRDLCNRVPTWAPLKGWPLELICEKSIGTCNRPLGAGEALRRVMECLASGILLPGG    211 - 280
PGLHDPCERDPTDALSYMTIQQKEDITHSAQHALRLSAFGQIYKVLEMDPLPSSKPFQKYSWSVTDKEGA    281 - 350
GSSALKRPFEDGLGDDKDPNKKMKRNLRKILDSKAIDLMNALMRLNQIRPGLQYKLLSQSGPVHAPVFTM    351 - 420
SVDVDGTTYEASGPSKKTAKLHVAVKVLQAMGYPTGFDADIECMSSDEKSDNESKNETVSSNSSNNTGNS    421 - 490
TTETSSTLEVRTQGPILTASGKNPVMELNEKRRGLKYELISETGGSHDKRFVMEVEVDGQKFRGAGPNKK    491 - 560
VAKASAALAALEKLFSGPNAANNKKKKIIPQAKGVVNTAVSAAVQAVRGRGRGTLTRGAFVGATAAPGYI    561 - 630
APGYGTPYGYSTAAPAYGLPKRMVLLPVMKFPTYPVPHYSFF                                631 - 672
//

Text Mined References (25)

PMID Year Title