Property Summary

NCBI Gene PubMed Count 20
Grant Count 1
Funding $550,985
PubMed Score 66.85
PubTator Score 46.38

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96SI9 Q32NB9 Q9BUE1 Q9BXG4 Q9H0B4 Q9H7V1 Q9NUK4
Symbols p74
SPNR
ILF3L
HEL162

Gene

 Grant Application (1)

PDB

2DMY  

Gene RIF (1)

PMID Text
22391137 Low STRBP mRNA is associated with cryptorchidism and Down's syndrome.

AA Sequence

MRSIRSFANDDRHVMVKHSTIYPSPEELEAVQNMVSTVECALKHVSDWLDETNKGTKTEGETEVKKDEAG      1 - 70
ENYSKDQGGRTLCGVMRIGLVAKGLLIKDDMDLELVLMCKDKPTETLLNTVKDNLPIQIQKLTEEKYQVE     71 - 140
QCVNEASIIIRNTKEPTLTLKVILTSPLIRDELEKKDGENVSMKDPPDLLDRQKCLNALASLRHAKWFQA    141 - 210
RANGLKSCVIVLRILRDLCNRVPTWAPLKGWPLELICEKSIGTCNRPLGAGEALRRVMECLASGILLPGG    211 - 280
PGLHDPCERDPTDALSYMTIQQKEDITHSAQHALRLSAFGQIYKVLEMDPLPSSKPFQKYSWSVTDKEGA    281 - 350
GSSALKRPFEDGLGDDKDPNKKMKRNLRKILDSKAIDLMNALMRLNQIRPGLQYKLLSQSGPVHAPVFTM    351 - 420
SVDVDGTTYEASGPSKKTAKLHVAVKVLQAMGYPTGFDADIECMSSDEKSDNESKNETVSSNSSNNTGNS    421 - 490
TTETSSTLEVRTQGPILTASGKNPVMELNEKRRGLKYELISETGGSHDKRFVMEVEVDGQKFRGAGPNKK    491 - 560
VAKASAALAALEKLFSGPNAANNKKKKIIPQAKGVVNTAVSAAVQAVRGRGRGTLTRGAFVGATAAPGYI    561 - 630
APGYGTPYGYSTAAPAYGLPKRMVLLPVMKFPTYPVPHYSFF                                631 - 672
//

Text Mined References (25)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
25416956 2014 A proteome-scale map of the human interactome network.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22391137 2012 Expression of STRBP mRNA in patients with cryptorchidism and Down's syndrome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
More...