Property Summary

NCBI Gene PubMed Count 15
Grant Count 8
R01 Count 8
Funding $801,727.8
PubMed Score 20.05
PubTator Score 10.54

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
sonic hedgehog group medulloblastoma 1.200 0.002
lung adenocarcinoma 1.100 0.002
lung carcinoma 1.100 0.000
ductal carcinoma in situ -2.000 0.000
invasive ductal carcinoma -2.500 0.000

Gene RIF (9)

PMID Text
26216026 The results indicate the antiapoptotic role of TBX15 in cancer cells, suggesting a contribution of TBX15 in carcinogenesis.
26105758 Two traits of ear pinna anatomic variation are associated with SNPs in a region overlapping the TBX15 gene.
24039145 We identified homozygosity for a novel nonsense mutation (c.841C>T) in TBX15 predicted to cause a premature stop (p.Arg281*) with truncation of the protein.
23670221 Genes within recently identified loci associated with waist-hip ratio (WHR) exhibit fat depot-specific mRNA expression, which correlates with obesity-related traits. Adipose tissue (AT) mRNA expression of 6 genes (TBX15/WARS2, STAB1, PIGC, ZNRF3, GRB14
20962579 TBX15 might be involved in the pathophysiology of placental diseases.
20935629 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20634891 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19068278 TBX15 mutations cause craniofacial dysmorphism, hypoplasia of scapula and pelvis, and short stature in Cousin syndrome.

AA Sequence

MSERRRSAVALSSRAHAFSVEALIGSNKKRKLRDWEEKGLDLSMEALSPAGPLGDTEDAAAHGLEPHPDS      1 - 70
EQSTGSDSEVLTERTSCSFSTHTDLASGAAGPVPAAMSSMEEIQVELQCADLWKRFHDIGTEMIITKAGR     71 - 140
RMFPAMRVKITGLDPHQQYYIAMDIVPVDNKRYRYVYHSSKWMVAGNADSPVPPRVYIHPDSLASGDTWM    141 - 210
RQVVSFDKLKLTNNELDDQGHIILHSMHKYQPRVHVIRKDFSSDLSPTKPVPVGDGVKTFNFPETVFTTV    211 - 280
TAYQNQQITRLKIDRNPFAKGFRDSGRNRTGLEAIMETYAFWRPPVRTLTFEDFTTMQKQQGGSTGTSPT    281 - 350
TSSTGTPSPSASSHLLSPSCSPPTFHLAPNTFNVGCRESQLCNLNLSDYPPCARSNMAALQSYPGLSDSG    351 - 420
YNRLQSGTTSATQPSETFMPQRTPSLISGIPTPPSLPGNSKMEAYGGQLGSFPTSQFQYVMQAGNAASSS    421 - 490
SSPHMFGGSHMQQSSYNAFSLHNPYNLYGYNFPTSPRLAASPEKLSASQSTLLCSSPSNGAFGERQYLPS    491 - 560
GMEHSMHMISPSPNNQQATNTCDGRQYGAVPGSSSQMSVHMV                                561 - 602
//

Text Mined References (17)

PMID Year Title
26216026 2015 Novel antiapoptotic effect of TBX15: overexpression of TBX15 reduces apoptosis in cancer cells.
26105758 2015 A genome-wide association study identifies multiple loci for variation in human ear morphology.
25416956 2014 A proteome-scale map of the human interactome network.
24039145 2013 Homozygosity for a novel truncating mutation confirms TBX15 deficiency as the cause of Cousin syndrome.
23708190 2013 A genome-wide association study identifies two risk loci for congenital heart malformations in Han Chinese populations.
23670221 2014 Fat depot-specific mRNA expression of novel loci associated with waist-hip ratio.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20962579 2011 Combination of promoter hypomethylation and PDX1 overexpression leads to TBX15 decrease in vascular IUGR placentas.
20935629 2010 Meta-analysis identifies 13 new loci associated with waist-hip ratio and reveals sexual dimorphism in the genetic basis of fat distribution.
20634891 2010 Maternal genes and facial clefts in offspring: a comprehensive search for genetic associations in two population-based cleft studies from Scandinavia.
More...