Property Summary

NCBI Gene PubMed Count 3
PubMed Score 154.90

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
sonic hedgehog group medulloblastoma 1482 0.00660965440057829
Disease Target Count Z-score Confidence
Extramedullary plasmacytoma 1 3.029 1.5

Expression

  Differential Expression (1)

Disease log2 FC p
sonic hedgehog group medulloblastoma 1.100 0.007

Synonym

Accession Q96SE7 B3KU77 B9EG59 G5E9N4 Q8TCN1
Symbols ZNF1111

Gene

PDB

2EMA   2EMP   2EN4   2ENE   2ENF   2EOE   2EOW   2EQ0   2EQ1   2EQ2   2EQ3   2YTI   2YTK   2YTN   2YTR   2YU8  

  Ortholog (1)

Species Source
Chimp OMA EggNOG

AA Sequence

MALTQGQVTFRDVAIEFSQEEWTCLDPAQRTLYRDVMLENYRNLASLGISCFDLSIISMLEQGKEPFTLE      1 - 70
SQVQIAGNPDGWEWIKAVITALSSEFVMKDLLHKGKSNTGEVFQTVMLERQESQDIEGCSFREVQKNTHG     71 - 140
LEYQCRDAEGNYKGVLLTQEGNLTHGRDEHDKRDARNKLIKNQLGLSLQSHLPELQLFQYEGKIYECNQV    141 - 210
EKSFNNNSSVSPPQQMPYNVKTHISKKYLKDFISSLLLTQGQKANNWGSPYKSNGCGMVFPQNSHLASHQ    211 - 280
RSHTKEKPYKCYECGKAFRTRSNLTTHQVIHTGEKRYKCNECGKVFSRNSQLSQHQKIHTGEKPYKCNEC    281 - 350
GKVFTQNSHLVRHRGIHTGEKPYKCNECGKAFRARSSLAIHQATHSGEKPYKCNECGKVFTQNSHLTNHW    351 - 420
RIHTGEKPYKCNECGKAFGVRSSLAIHLVIHTGEKPYKCHECGKVFRRNSHLARHQLIHTGEKPYKCNEC    421 - 490
GKAFRAHSNLTTHQVIHTGEKPYKCNECGKVFTQNSHLANHQRIHTGVKPYMCNECGKAFSVYSSLTTHQ    491 - 560
VIHTGEKPYKCNECGKVFTQNSHLARHRGIHTGEKPYKCNECGKVFRHNSYLSRHQRIHTGEKPYKYNEY    561 - 630
GKAFSEHSNLTTHQVIHTGEKPYKCNECGKVFTQNSHLARHRRVHTGGKPYQCNECGKAFSQTSKLARHQ    631 - 700
RVHTGEKPYECNQCGKAFSVRSSLTTHQAIHTGKKPYKCNECGKVFTQNSHLARHRGIHTGEKPYKCNEC    701 - 770
GKAFSQTSKLARHQRIHTGEKPYECGKPFSICSSLTTHQTIHTGGKPYKCNVWKVLKSEFKPCKPSQNS     771 - 839
//

Text Mined References (6)

PMID Year Title
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.