Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.20
PubTator Score 1.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ovarian cancer 8492 2.26586301476632E-8
medulloblastoma, large-cell 6234 4.58157488639931E-5
osteosarcoma 7933 7.78540728276357E-5
atypical teratoid / rhabdoid tumor 4369 9.4010056216949E-4
adult high grade glioma 2148 0.00187305886254836
Disease Target Count Z-score Confidence
Intestinal disease 11 0.0 2.0

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.024 0.000
atypical teratoid / rhabdoid tumor 1.100 0.001
medulloblastoma, large-cell 1.500 0.000
adult high grade glioma 1.100 0.002
ovarian cancer 1.300 0.000

Synonym

Accession Q96SE0 B3KSF6 E9PDR9 Q05BY3 Q53SZ1 Q8IXQ7
Symbols LABH1

Gene

PANTHER Protein Class (1)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum EggNOG Inparanoid
C. elegans OMA Inparanoid

Gene RIF (1)

PMID Text
11922611 The mouse ortholog of ABHD1 is sequenced and tissue-specific mRNA expression is described.

AA Sequence

MLSSFLSPQNGTWADTFSLLLALAVALYLGYYWACVLQRPRLVAGPQFLAFLEPHCSITTETFYPTLWCF      1 - 70
EGRLQSIFQVLLQSQPLVLYQSDILQTPDGGQLLLDWAKQPDSSQDPDPTTQPIVLLLPGITGSSQDTYV     71 - 140
LHLVNQALRDGYQAVVFNNRGCRGEELRTHRAFCASNTEDLETVVNHIKHRYPQAPLLAVGISFGGILVL    141 - 210
NHLAQARQAAGLVAALTLSACWDSFETTRSLETPLNSLLFNQPLTAGLCQLVERNRKVIEKVVDIDFVLQ    211 - 280
ARTIRQFDERYTSVAFGYQDCVTYYKAASPRTKIDAIRIPVLYLSAADDPFSPVCALPIQAAQHSPYVAL    281 - 350
LITARGGHIGFLEGLLPWQHWYMSRLLHQYAKAIFQDPEGLPDLRALLPSEDRNS                   351 - 405
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12735795 2003 The gene structure and expression of human ABHD1: overlapping polyadenylation signal sequence with Sec12.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11922611 2002 Cloning and tissue distribution of three murine alpha/beta hydrolase fold protein cDNAs.