Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.20
PubTator Score 1.17

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma 1.024 0.000
atypical teratoid / rhabdoid tumor 1.100 0.001
medulloblastoma, large-cell 1.500 0.000
adult high grade glioma 1.100 0.002
ovarian cancer 1.300 0.000

Gene RIF (1)

PMID Text
11922611 The mouse ortholog of ABHD1 is sequenced and tissue-specific mRNA expression is described.

AA Sequence

MLSSFLSPQNGTWADTFSLLLALAVALYLGYYWACVLQRPRLVAGPQFLAFLEPHCSITTETFYPTLWCF      1 - 70
EGRLQSIFQVLLQSQPLVLYQSDILQTPDGGQLLLDWAKQPDSSQDPDPTTQPIVLLLPGITGSSQDTYV     71 - 140
LHLVNQALRDGYQAVVFNNRGCRGEELRTHRAFCASNTEDLETVVNHIKHRYPQAPLLAVGISFGGILVL    141 - 210
NHLAQARQAAGLVAALTLSACWDSFETTRSLETPLNSLLFNQPLTAGLCQLVERNRKVIEKVVDIDFVLQ    211 - 280
ARTIRQFDERYTSVAFGYQDCVTYYKAASPRTKIDAIRIPVLYLSAADDPFSPVCALPIQAAQHSPYVAL    281 - 350
LITARGGHIGFLEGLLPWQHWYMSRLLHQYAKAIFQDPEGLPDLRALLPSEDRNS                   351 - 405
//

Text Mined References (7)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12735795 2003 The gene structure and expression of human ABHD1: overlapping polyadenylation signal sequence with Sec12.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11922611 2002 Cloning and tissue distribution of three murine alpha/beta hydrolase fold protein cDNAs.