Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.20
PubTator Score 1.17

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (5)

Disease log2 FC p
adult high grade glioma 1.100 1.9e-03
atypical teratoid / rhabdoid tumor 1.100 9.4e-04
medulloblastoma, large-cell 1.500 4.6e-05
osteosarcoma 1.024 7.8e-05
ovarian cancer 1.300 2.3e-08

Gene RIF (1)

AA Sequence

MLSSFLSPQNGTWADTFSLLLALAVALYLGYYWACVLQRPRLVAGPQFLAFLEPHCSITTETFYPTLWCF      1 - 70
EGRLQSIFQVLLQSQPLVLYQSDILQTPDGGQLLLDWAKQPDSSQDPDPTTQPIVLLLPGITGSSQDTYV     71 - 140
LHLVNQALRDGYQAVVFNNRGCRGEELRTHRAFCASNTEDLETVVNHIKHRYPQAPLLAVGISFGGILVL    141 - 210
NHLAQARQAAGLVAALTLSACWDSFETTRSLETPLNSLLFNQPLTAGLCQLVERNRKVIEKVVDIDFVLQ    211 - 280
ARTIRQFDERYTSVAFGYQDCVTYYKAASPRTKIDAIRIPVLYLSAADDPFSPVCALPIQAAQHSPYVAL    281 - 350
LITARGGHIGFLEGLLPWQHWYMSRLLHQYAKAIFQDPEGLPDLRALLPSEDRNS                   351 - 405
//

Text Mined References (7)

PMID Year Title