Property Summary

NCBI Gene PubMed Count 24
Grant Count 40
R01 Count 38
Funding $2,950,253.7
PubMed Score 19.95
PubTator Score 13.40

Knowledge Summary

Patent

No data available

Expression

Gene RIF (10)

PMID Text
26983541 results uncover a novel role for the Smc5/6 complex as a restriction factor selectively blocking extrachromosomal DNA transcription; by destroying this complex, HBx relieves the inhibition to allow productive hepatitis B virus gene expression
25145851 Structural maintenance of chromosomes (SMC) complexes, which in eukaryotic cells include cohesin, condensin and the Smc5/6 complex, are central regulators of chromosome dynamics
24258023 Depletion of Smc5 and Smc6 resulted in aberrant mitotic chromosome phenotypes that were accompanied by the abnormal distribution of topoisomerase IIalpha (topo IIalpha) and condensins and by chromosome segregation errors
21550342 Studies indicate that Nse1 may function as a ubiquitin ligase, and is targeted to chromatin through its interaction with the Smc5/6 complex.
20056645 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18667531 Nse1 RING-like motif is a protein-protein interaction domain required for Smc5-Smc6 holocomplex integrity and recruitment to, or retention at, DNA lesions
18086888 The four non-SMC components of the human complex were identified and characterized and it was demonstrated that the MAGEG1 protein is part of this complex.
17589526 SMC5/6 complex facilitates telomere homologous recombination and elongation in alternative lengthening of telomeres cells through SUMOylation of telomere-binding proteins.
16810316 SMC5/6 complex is recruited to nuclease-induced double-strand breaks (DSBs) and is required for the recruitment of cohesin to DSBs.
16055714 the human SMC5/6 complex and the SUMO ligase activity of hMMS21 are required for the prevention of DNA damage-induced apoptosis by facilitating DNA repair in human cells

AA Sequence

MAKRKEENFSSPKNAKRPRQEELEDFDKDGDEDECKGTTLTAAEVGIIESIHLKNFMCHSMLGPFKFGSN      1 - 70
VNFVVGNNGSGKSAVLTALIVGLGGRAVATNRGSSLKGFVKDGQNSADISITLRNRGDDAFKASVYGNSI     71 - 140
LIQQHISIDGSRSYKLKSATGSVVSTRKEELIAILDHFNIQVDNPVSVLTQEMSKQFLQSKNEGDKYKFF    141 - 210
MKATQLEQMKEDYSYIMETKERTKEQIHQGEERLTELKRQCVEKEERFQSIAGLSTMKTNLESLKHEMAW    211 - 280
AVVNEIEKQLNAIRDNIKIGEDRAARLDRKMEEQQVRLNEAEQKYKDIQDKLEKISEETNARAPECMALK    281 - 350
ADVVAKKRAYNEAEVLYNRSLNEYKALKKDDEQLCKRIEELKKSTDQSLEPERLERQKKISWLKERVKAF    351 - 420
QNQENSVNQEIEQFQQAIEKDKEEHGKIKREELDVKHALSYNQRQLKELKDSKTDRLKRFGPNVPALLEA    421 - 490
IDDAYRQGHFTYKPVGPLGACIHLRDPELALAIESCLKGLLQAYCCHNHADERVLQALMKRFYLPGTSRP    491 - 560
PIIVSEFRNEIYDVRHRAAYHPDFPTVLTALEIDNAVVANSLIDMRGIETVLLIKNNSVARAVMQSQKPP    561 - 630
KNCREAFTADGDQVFAGRYYSSENTRPKFLSRDVDSEISDLENEVENKTAQILNLQQHLSALEKDIKHNE    631 - 700
ELLKRCQLHYKELKMKIRKNISEIRELENIEEHQSVDIATLEDEAQENKSKMKMVEEHMEQQKENMEHLK    701 - 770
SLKIEAENKYDAIKFKINQLSELADPLKDELNLADSEVDNQKRGKRHYEEKQKEHLDTLNKKKRELDMKE    771 - 840
KELEEKMSQARQICPERIEVEKSASILDKEINRLRQKIQAEHASHGDREEIMRQYQEARETYLDLDSKVR    841 - 910
TLKKFIKLLGEIMEHRFKTYQQFRRCLTLRCKLYFDNLLSQRAYCGKMNFDHKNETLSISVQPGEGNKAA    911 - 980
FNDMRALSGGERSFSTVCFILSLWSIAESPFRCLDEFDVYMDMVNRRIAMDLILKMADSQRFRQFILLTP    981 - 1050
QSMSSLPSSKLIRILRMSDPERGQTTLPFRPVTQEEDDDQR                                1051 - 1091
//

Text Mined References (29)

PMID Year Title
26983541 2016 Hepatitis B virus X protein identifies the Smc5/6 complex as a host restriction factor.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25931565 2015 DNA repair. Proteomics reveals dynamic assembly of repair complexes during bypass of DNA cross-links.
25145851 2014 The maintenance of chromosome structure: positioning and functioning of SMC complexes.
24258023 2014 Smc5/6-mediated regulation of replication progression contributes to chromosome assembly during mitosis in human cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21550342 2011 The Nse2/Mms21 SUMO ligase of the Smc5/6 complex in the maintenance of genome stability.
21269460 2011 Initial characterization of the human central proteome.
20056645 2010 Association of mitotic regulation pathway polymorphisms with pancreatic cancer risk and outcome.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...