Property Summary

NCBI Gene PubMed Count 72
Grant Count 50
R01 Count 35
Funding $6,787,794.93
PubMed Score 68.99
PubTator Score 68.33

Knowledge Summary

Patent (3,171)

Expression

  Differential Expression (12)

Synonym

Accession Q96SB4 B4DS61 Q12890 Q5R364 Q5R365 Q8IY12
Symbols SFRSK1

Gene

PDB

1WBP   1WAK   3BEG   4WUA  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
652206 other 0 / 0 / 0 ML-187 activity in a kinase panel for Extended probe characterization for beta-cell apoptosis Measured in Biochemical System

Gene RIF (41)

PMID Text
26500332 SRPK1 is upregulated in prostate cancer and correlates with disease stage and invasion.
26244849 Data indicate serine/arginine-rich protein kinases SRPK1/2/SRPIN340 complexes by molecular docking and molecular dynamics.
26099172 SRPK1 mediates TGF-beta-induced proliferation.
26013829 SRPK1 is a regulator of Tra2beta1 splicing function and individual domains engage in considerable cross-talk, assuming novel functions with regard to RNA binding, splicing, and catalysis.
25833691 SRPK1 may be a potential anticancer target to inhibit glioma progression.
25774502 SRPK1 was highly expressed in basal breast cancer. High SRPK1 expression correlated with poor breast cancer disease outcome and preferential metastasis to the lungs and brain.
25529026 Data suggest that proline phosphorylation by CLK1/CDC-like kinase 1 (but not by SRPK1/serine/arginine-rich splicing factor kinase 1) regulates conformation and alternative splicing function of SFRS1 (serine/arginine-rich splicing factor 1).
25381816 Modulation of SRPK1 and subsequent inhibition of tumour angiogenesis.
25187541 ERK1/2 signal induced MNK catalytic activity enabled enterovirus type 1 internal ribosomal entry site-mediated translation/host cell cytotoxicity through negative regulation of the Ser/Arg (SR)-rich protein kinase (SRPK).
25187540 Authors show that MNK regulates SRPK via mTOR and AKT.
More...

AA Sequence

MERKVLALQARKKRTKAKKDKAQRKSETQHRGSAPHSESDLPEQEEEILGSDDDEQEDPNDYCKGGYHLV      1 - 70
KIGDLFNGRYHVIRKLGWGHFSTVWLSWDIQGKKFVAMKVVKSAEHYTETALDEIRLLKSVRNSDPNDPN     71 - 140
REMVVQLLDDFKISGVNGTHICMVFEVLGHHLLKWIIKSNYQGLPLPCVKKIIQQVLQGLDYLHTKCRII    141 - 210
HTDIKPENILLSVNEQYIRRLAAEATEWQRSGAPPPSGSAVSTAPQPKPADKMSKNKKKKLKKKQKRQAE    211 - 280
LLEKRMQEIEEMEKESGPGQKRPNKQEESESPVERPLKENPPNKMTQEKLEESSTIGQDQTLMERDTEGG    281 - 350
AAEINCNGVIEVINYTQNSNNETLRHKEDLHNANDCDVQNLNQESSFLSSQNGDSSTSQETDSCTPITSE    351 - 420
VSDTMVCQSSSTVGQSFSEQHISQLQESIRAEIPCEDEQEQEHNGPLDNKGKSTAGNFLVNPLEPKNAEK    421 - 490
LKVKIADLGNACWVHKHFTEDIQTRQYRSLEVLIGSGYNTPADIWSTACMAFELATGDYLFEPHSGEEYT    491 - 560
RDEDHIALIIELLGKVPRKLIVAGKYSKEFFTKKGDLKHITKLKPWGLFEVLVEKYEWSQEEAAGFTDFL    561 - 630
LPMLELIPEKRATAAECLRHPWLNS                                                 631 - 655
//

Text Mined References (85)

PMID Year Title
26500332 2016 Serine-arginine protein kinase 1 (SRPK1), a determinant of angiogenesis, is upregulated in prostate cancer and correlates with disease stage and invasion.
26244849 2015 Potential Antileukemia Effect and Structural Analyses of SRPK Inhibition by N-(2-(Piperidin-1-yl)-5-(Trifluoromethyl)Phenyl)Isonicotinamide (SRPIN340).
26099172 2015 The crucial role of SRPK1 in TGF-?-induced proliferation and apoptosis in the esophageal squamous cell carcinomas.
26013829 2015 Intra-domain Cross-talk Regulates Serine-arginine Protein Kinase 1-dependent Phosphorylation and Splicing Function of Transformer 2?1.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25833691 2015 The influence of SRPK1 on glioma apoptosis, metastasis, and angiogenesis through the PI3K/Akt signaling pathway under normoxia.
25774502 2015 Tumor cell migration screen identifies SRPK1 as breast cancer metastasis determinant.
25529026 2015 Conserved proline-directed phosphorylation regulates SR protein conformation and splicing function.
25381816 2015 Serine-arginine protein kinase 1 (SRPK1) inhibition as a potential novel targeted therapeutic strategy in prostate cancer.
25187541 2014 Induction of viral, 7-methyl-guanosine cap-independent translation and oncolysis by mitogen-activated protein kinase-interacting kinase-mediated effects on the serine/arginine-rich protein kinase.
More...