Property Summary

Ligand Count 2
NCBI Gene PubMed Count 81
PubMed Score 75.26
PubTator Score 68.33

Knowledge Summary

Patent (3,171)

Expression

  Differential Expression (12)

Disease log2 FC p
Breast cancer 1.100 2.7e-07
cutaneous lupus erythematosus 1.100 4.8e-03
ductal carcinoma in situ 1.100 5.7e-04
intraductal papillary-mucinous carcinoma... 1.200 9.4e-03
invasive ductal carcinoma 1.100 1.9e-02
lung adenocarcinoma 1.070 1.5e-04
lung cancer 2.200 8.2e-04
medulloblastoma, large-cell 1.500 7.6e-04
non-small cell lung cancer 1.105 1.7e-17
osteosarcoma 1.445 3.7e-03
psoriasis 1.100 3.4e-09
subependymal giant cell astrocytoma -1.335 1.7e-02

Gene RIF (50)

AA Sequence

MERKVLALQARKKRTKAKKDKAQRKSETQHRGSAPHSESDLPEQEEEILGSDDDEQEDPNDYCKGGYHLV      1 - 70
KIGDLFNGRYHVIRKLGWGHFSTVWLSWDIQGKKFVAMKVVKSAEHYTETALDEIRLLKSVRNSDPNDPN     71 - 140
REMVVQLLDDFKISGVNGTHICMVFEVLGHHLLKWIIKSNYQGLPLPCVKKIIQQVLQGLDYLHTKCRII    141 - 210
HTDIKPENILLSVNEQYIRRLAAEATEWQRSGAPPPSGSAVSTAPQPKPADKMSKNKKKKLKKKQKRQAE    211 - 280
LLEKRMQEIEEMEKESGPGQKRPNKQEESESPVERPLKENPPNKMTQEKLEESSTIGQDQTLMERDTEGG    281 - 350
AAEINCNGVIEVINYTQNSNNETLRHKEDLHNANDCDVQNLNQESSFLSSQNGDSSTSQETDSCTPITSE    351 - 420
VSDTMVCQSSSTVGQSFSEQHISQLQESIRAEIPCEDEQEQEHNGPLDNKGKSTAGNFLVNPLEPKNAEK    421 - 490
LKVKIADLGNACWVHKHFTEDIQTRQYRSLEVLIGSGYNTPADIWSTACMAFELATGDYLFEPHSGEEYT    491 - 560
RDEDHIALIIELLGKVPRKLIVAGKYSKEFFTKKGDLKHITKLKPWGLFEVLVEKYEWSQEEAAGFTDFL    561 - 630
LPMLELIPEKRATAAECLRHPWLNS                                                 631 - 655
//

Text Mined References (94)

PMID Year Title