Property Summary

NCBI Gene PubMed Count 35
PubMed Score 0.00
PubTator Score 24.73

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma -1.481 0.000
group 3 medulloblastoma -1.700 0.005
posterior fossa group B ependymoma -1.400 0.000

Synonym

Accession Q96SB3 Q8TCR9
Symbols Spn
SPINO
PPP1R6
PPP1R9

Gene

Gene RIF (17)

PMID Text
25857299 Low spinophilin expression enhances aggressive biological behavior of breast cancer.
25261368 Colorectal carcinoma expression of spinophilin expression determines cellular growth, cancer stemness and 5-flourouracil resistance.
24565202 spinophilin might play a previously unrecognized role in the pathogenesis of head and neck squamous cell carcinoma
23729363 Spn downregulation contributes to a more aggressive biologic behavior, induces chemoresistance, and is associated with a poorer survival in patients with advanced stages of colorectal carcinoma.
23591196 study found a substantial number of hepatocellular carcinomas (HCC) show reduced or absent Spn expression; the low expression of Spn in tumour tissue is an independent negative prognostic factor for clinical outcome in HCC; spinophilin expression inversely correlates with proliferative activity
22922354 Spinophilin associates with both delta- and mu-OmicronR and G protein subunits in HEK293 cells participating in a multimeric signaling complex that displays a differential regulatory role in opioid receptor signaling.
22369787 Spinophilin-deficient mice have enhanced antidepressant response to desipramine compared with wild-type controls.
22284538 Studies suggest that any change in substrate specificity of the spinophilin : PP1 holoenzyme complex was probably due to direct modification of a PP1 substrate binding surface.
22210881 Data show that that SPL/RGS/SHP1 complexes are present in resting platelets where constitutive phosphorylation of SPL(Y398) creates an atypical binding site for SHP-1.
22054094 The molecular size and subcellular location of myotube glycogen particles is determined by the PPP1R6, PTG and G(M) scaffolding.
More...

AA Sequence

MMKTEPRGPGGPLRSASPHRSAYEAGIQALKPPDAPGPDEAPKGAHHKKYGSNVHRIKSMFLQMGTTAGP      1 - 70
SGEAGGGAGLAEAPRASERGVRLSLPRASSLNENVDHSALLKLGTSVSERVSRFDSKPAPSAQPAPPPHP     71 - 140
PSRLQETRKLFERSAPAAGGDKEAARRLLRQERAGLQDRKLDVVVRFNGSTEALDKLDADAVSPTVSQLS    141 - 210
AVFEKADSRTGLHRGPGLPRAAGVPQVNSKLVSKRSRVFQPPPPPPPAPSGDAPAEKERCPAGQQPPQHR    211 - 280
VAPARPPPKPREVRKIKPVEVEESGESEAESAPGEVIQAEVTVHAALENGSTVATAASPAPEEPKAQAAP    281 - 350
EKEAAAVAPPERGVGNGRAPDVAPEEVDESKKEDFSEADLVDVSAYSGLGEDSAGSALEEDDEDDEEDGE    351 - 420
PPYEPESGCVEIPGLSEEEDPAPSRKIHFSTAPIQVFSTYSNEDYDRRNEDVDPMAASAEYELEKRVERL    421 - 490
ELFPVELEKDSEGLGISIIGMGAGADMGLEKLGIFVKTVTEGGAAHRDGRIQVNDLLVEVDGTSLVGVTQ    491 - 560
SFAASVLRNTKGRVRFMIGRERPGEQSEVAQLIQQTLEQERWQREMMEQRYAQYGEDDEETGEYATDEDE    561 - 630
ELSPTFPGGEMAIEVFELAENEDALSPVDMEPEKLVHKFKELQIKHAVTEAEIQQLKRKLQSLEQEKGRW    631 - 700
RVEKAQLEQSVEENKERMEKLEGYWGEAQSLCQAVDEHLRETQAQYQALERKYSKAKRLIKDYQQKEIEF    701 - 770
LKKETAQRRVLEESELARKEEMDKLLDKISELEGNLQTLRNSNST                             771 - 815
//

Text Mined References (43)

PMID Year Title
25857299 2015 Low spinophilin expression enhances aggressive biological behavior of breast cancer.
25261368 2014 Spinophilin expression determines cellular growth, cancer stemness and 5-flourouracil resistance in colorectal cancer.
24565202 2014 Loss of the putative tumor suppressor protein spinophilin is associated with poor prognosis in head and neck cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24114805 2014 The ?2B-adrenergic receptor is mutant in cortical myoclonus and epilepsy.
23729363 2013 Spinophilin loss correlates with poor patient prognosis in advanced stages of colon carcinoma.
23591196 2013 Low expression of the putative tumour suppressor spinophilin is associated with higher proliferative activity and poor prognosis in patients with hepatocellular carcinoma.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22922354 2012 Selective interactions of spinophilin with the C-terminal domains of the ?- and ?-opioid receptors and G proteins differentially modulate opioid receptor signaling.
22515982 2012 Spinophilin: a new tumor suppressor at 17q21.
More...