Property Summary

NCBI Gene PubMed Count 42
PubMed Score 0.00
PubTator Score 24.73

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Sinusitis 65 0.0 0.0
Disease Target Count
Schizophrenia 1160
Disease Target Count P-value
posterior fossa group B ependymoma 416 1.2e-05
osteosarcoma 7950 1.5e-05
group 3 medulloblastoma 4104 5.1e-03

Expression

  Differential Expression (3)

Disease log2 FC p
group 3 medulloblastoma -1.700 5.1e-03
osteosarcoma -1.481 1.5e-05
posterior fossa group B ependymoma -1.400 1.2e-05

Gene RIF (22)

AA Sequence

MMKTEPRGPGGPLRSASPHRSAYEAGIQALKPPDAPGPDEAPKGAHHKKYGSNVHRIKSMFLQMGTTAGP      1 - 70
SGEAGGGAGLAEAPRASERGVRLSLPRASSLNENVDHSALLKLGTSVSERVSRFDSKPAPSAQPAPPPHP     71 - 140
PSRLQETRKLFERSAPAAGGDKEAARRLLRQERAGLQDRKLDVVVRFNGSTEALDKLDADAVSPTVSQLS    141 - 210
AVFEKADSRTGLHRGPGLPRAAGVPQVNSKLVSKRSRVFQPPPPPPPAPSGDAPAEKERCPAGQQPPQHR    211 - 280
VAPARPPPKPREVRKIKPVEVEESGESEAESAPGEVIQAEVTVHAALENGSTVATAASPAPEEPKAQAAP    281 - 350
EKEAAAVAPPERGVGNGRAPDVAPEEVDESKKEDFSEADLVDVSAYSGLGEDSAGSALEEDDEDDEEDGE    351 - 420
PPYEPESGCVEIPGLSEEEDPAPSRKIHFSTAPIQVFSTYSNEDYDRRNEDVDPMAASAEYELEKRVERL    421 - 490
ELFPVELEKDSEGLGISIIGMGAGADMGLEKLGIFVKTVTEGGAAHRDGRIQVNDLLVEVDGTSLVGVTQ    491 - 560
SFAASVLRNTKGRVRFMIGRERPGEQSEVAQLIQQTLEQERWQREMMEQRYAQYGEDDEETGEYATDEDE    561 - 630
ELSPTFPGGEMAIEVFELAENEDALSPVDMEPEKLVHKFKELQIKHAVTEAEIQQLKRKLQSLEQEKGRW    631 - 700
RVEKAQLEQSVEENKERMEKLEGYWGEAQSLCQAVDEHLRETQAQYQALERKYSKAKRLIKDYQQKEIEF    701 - 770
LKKETAQRRVLEESELARKEEMDKLLDKISELEGNLQTLRNSNST                             771 - 815
//

Text Mined References (50)

PMID Year Title