Property Summary

NCBI Gene PubMed Count 12
PubMed Score 7.54
PubTator Score 3.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
active Crohn's disease -1.578 1.6e-02
adult high grade glioma 1.300 2.5e-03
ductal carcinoma in situ 2.000 1.4e-03
glioblastoma 1.600 2.5e-04
interstitial cystitis -1.800 4.5e-03
intraductal papillary-mucinous carcinoma... 1.500 4.7e-04
invasive ductal carcinoma 2.300 5.0e-03
lung carcinoma -1.200 2.2e-17
medulloblastoma 1.100 3.0e-03
non-small cell lung cancer 1.593 3.6e-12
ovarian cancer 1.500 5.1e-08
pancreatic cancer 1.200 1.8e-05
primary pancreatic ductal adenocarcinoma 1.301 1.2e-02
primary Sjogren syndrome -1.100 1.1e-02
primitive neuroectodermal tumor 1.400 7.2e-03
ulcerative colitis -1.100 1.1e-03

Gene RIF (4)

AA Sequence

MGACLGACSLLSCASCLCGSAPCILCSCCPASRNSTVSRLIFTFFLFLGVLVSIIMLSPGVESQLYKLPW      1 - 70
VCEEGAGIPTVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSSSRDPRAAIQNGFWFFKFLIL     71 - 140
VGLTVGAFYIPDGSFTNIWFYFGVVGSFLFILIQLVLLIDFAHSWNQRWLGKAEECDSRAWYAGLFFFTL    141 - 210
LFYLLSIAAVALMFMYYTEPSGCHEGKVFISLNLTFCVCVSIAAVLPKVQDAQPNSGLLQASVITLYTMF    211 - 280
VTWSALSSIPEQKCNPHLPTQLGNETVVAGPEGYETQWWDAPSIVGLIIFLLCTLFISLRSSDHRQVNSL    281 - 350
MQTEECPPMLDATQQQQQVAACEGRAFDNEQDGVTYSYSFFHFCLVLASLHVMMTLTNWYKPGETRKMIS    351 - 420
TWTAVWVKICASWAGLLLYLWTLVAPLLLRNRDFS                                       421 - 455
//

Text Mined References (13)

PMID Year Title