Property Summary

NCBI Gene PubMed Count 12
PubMed Score 6.21
PubTator Score 3.75

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96SA4 A0AVB4 B4DJK5 B7Z567 B7ZAP2 E7EUZ9 Q86Y23
Symbols TDE2
TDE2L
FKSG84
PRO0899

Gene

Gene RIF (4)

PMID Text
24424505 TDE2 may have an effect on tumor cell growth by influencing the expression of SREBP and p21.
23778322 study concluded that SERINC2 was a replicable and significant risk gene specific for alcohol dependence in individuals of European descent
23455491 In subjects of European descent, SERINC2-NKAIN1 expression of genes is associated with alcohol dependence.
21752829 SERINC2 protein localizes in lysosomes in HeLa cells

AA Sequence

MGACLGACSLLSCASCLCGSAPCILCSCCPASRNSTVSRLIFTFFLFLGVLVSIIMLSPGVESQLYKLPW      1 - 70
VCEEGAGIPTVLQGHIDCGSLLGYRAVYRMCFATAAFFFFFTLLMLCVSSSRDPRAAIQNGFWFFKFLIL     71 - 140
VGLTVGAFYIPDGSFTNIWFYFGVVGSFLFILIQLVLLIDFAHSWNQRWLGKAEECDSRAWYAGLFFFTL    141 - 210
LFYLLSIAAVALMFMYYTEPSGCHEGKVFISLNLTFCVCVSIAAVLPKVQDAQPNSGLLQASVITLYTMF    211 - 280
VTWSALSSIPEQKCNPHLPTQLGNETVVAGPEGYETQWWDAPSIVGLIIFLLCTLFISLRSSDHRQVNSL    281 - 350
MQTEECPPMLDATQQQQQVAACEGRAFDNEQDGVTYSYSFFHFCLVLASLHVMMTLTNWYKPGETRKMIS    351 - 420
TWTAVWVKICASWAGLLLYLWTLVAPLLLRNRDFS                                       421 - 455
//

Text Mined References (13)

PMID Year Title
24424505 2014 siRNA-mediated knockdown of hTDE2 retards cell cycle progression through transcriptional activation of p21.
23778322 2013 Rare SERINC2 variants are specific for alcohol dependence in individuals of European descent.
23455491 2013 NKAIN1-SERINC2 is a functional, replicable and genome-wide significant risk gene region specific for alcohol dependence in subjects of European descent.
21752829 2011 Characterization of the CLEAR network reveals an integrated control of cellular clearance pathways.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
More...