Property Summary

NCBI Gene PubMed Count 13
PubMed Score 10.75
PubTator Score 5.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
lung carcinoma 2844 2.25801742689131E-23
non-small cell lung cancer 2798 1.54195881402003E-15
Breast cancer 3099 1.1595579485673E-10
lung adenocarcinoma 2714 1.52786700396487E-10
juvenile dermatomyositis 1189 2.41041988070378E-10
chronic lymphosyte leukemia 232 6.97419373978414E-10
group 4 medulloblastoma 1875 1.45500689354795E-7
Duchenne muscular dystrophy 602 2.10409893734999E-7
psoriasis 6685 3.20840771712949E-6
medulloblastoma, large-cell 6234 2.32258722567314E-5
fascioscapulohumeral muscular dystrophy 100 2.76568617260471E-5
ovarian cancer 8492 3.36666591407812E-5
limb girdle muscular dystrophy 2A 156 2.14325677305737E-4
autosomal dominant Emery-Dreifuss muscular dystrophy 499 2.41164087351286E-4
primary pancreatic ductal adenocarcinoma 1271 6.11976346256588E-4
atypical teratoid / rhabdoid tumor 4369 0.00106940737747703
pancreatic cancer 2300 0.00220372193622028
astrocytic glioma 2241 0.00290304268163312
invasive ductal carcinoma 2950 0.00408650189302461
gastric carcinoma 832 0.00776563070408494
Becker muscular dystrophy 187 0.00867840621489653
oligodendroglioma 2849 0.00888863251143903
ductal carcinoma in situ 1745 0.0242541787176852
osteosarcoma 7933 0.0364887083300446
sarcoidosis 368 0.0393387161970453

Expression

Synonym

Accession Q96S97 B2RE58 Q542Z1 Q7Z507 Q8N9R4 Q96CS6 Q96SK9
Symbols SB135

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA EggNOG

Gene RIF (3)

PMID Text
23264465 MYADM controls endothelial barrier function through ERM-dependent regulation of ICAM-1 expression.
21325632 Myeloid-associated differentiation marker (MYADM) regulates Rac1 targeting to ordered membranes required for cell spreading and migration.
12075932 Cloning and characterization of human MYADM gene whose expression was up-regulated in NB4 cells induced by all-trans retinoic acid.

AA Sequence

MPVTVTRTTITTTTTSSSGLGSPMIVGSPRALTQPLGLLRLLQLVSTCVAFSLVASVGAWTGSMGNWSMF      1 - 70
TWCFCFSVTLIILIVELCGLQARFPLSWRNFPITFACYAALFCLSASIIYPTTYVQFLSHGRSRDHAIAA     71 - 140
TFFSCIACVAYATEVAWTRARPGEITGYMATVPGLLKVLETFVACIIFAFISDPNLYQHQPALEWCVAVY    141 - 210
AICFILAAIAILLNLGECTNVLPIPFPSFLSGLALLSVLLYATALVLWPLYQFDEKYGGQPRRSRDVSCS    211 - 280
RSHAYYVCAWDRRLAVAILTAINLLAYVADLVHSAHLVFVKV                                281 - 322
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23264465 2013 MYADM controls endothelial barrier function through ERM-dependent regulation of ICAM-1 expression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21325632 2011 MYADM regulates Rac1 targeting to ordered membranes required for cell spreading and migration.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17097684 2007 Membrane protein hMYADM preferentially expressed in myeloid cells is up-regulated during differentiation of stem cells and myeloid leukemia cells.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15900300 2005 Analysis of differential gene expression in human melanocytic tumour lesions by custom made oligonucleotide arrays.
More...