Property Summary

NCBI Gene PubMed Count 13
PubMed Score 10.75
PubTator Score 5.62

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96S97 B2RE58 Q542Z1 Q7Z507 Q8N9R4 Q96CS6 Q96SK9
Symbols SB135

Gene

Gene RIF (3)

PMID Text
23264465 MYADM controls endothelial barrier function through ERM-dependent regulation of ICAM-1 expression.
21325632 Myeloid-associated differentiation marker (MYADM) regulates Rac1 targeting to ordered membranes required for cell spreading and migration.
12075932 Cloning and characterization of human MYADM gene whose expression was up-regulated in NB4 cells induced by all-trans retinoic acid.

AA Sequence

MPVTVTRTTITTTTTSSSGLGSPMIVGSPRALTQPLGLLRLLQLVSTCVAFSLVASVGAWTGSMGNWSMF      1 - 70
TWCFCFSVTLIILIVELCGLQARFPLSWRNFPITFACYAALFCLSASIIYPTTYVQFLSHGRSRDHAIAA     71 - 140
TFFSCIACVAYATEVAWTRARPGEITGYMATVPGLLKVLETFVACIIFAFISDPNLYQHQPALEWCVAVY    141 - 210
AICFILAAIAILLNLGECTNVLPIPFPSFLSGLALLSVLLYATALVLWPLYQFDEKYGGQPRRSRDVSCS    211 - 280
RSHAYYVCAWDRRLAVAILTAINLLAYVADLVHSAHLVFVKV                                281 - 322
//

Text Mined References (17)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23264465 2013 MYADM controls endothelial barrier function through ERM-dependent regulation of ICAM-1 expression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21325632 2011 MYADM regulates Rac1 targeting to ordered membranes required for cell spreading and migration.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17097684 2007 Membrane protein hMYADM preferentially expressed in myeloid cells is up-regulated during differentiation of stem cells and myeloid leukemia cells.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
15900300 2005 Analysis of differential gene expression in human melanocytic tumour lesions by custom made oligonucleotide arrays.
More...