Property Summary

NCBI Gene PubMed Count 14
PubMed Score 11.00
PubTator Score 5.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (25)

Disease log2 FC p
astrocytic glioma -1.200 4.1e-03
atypical teratoid / rhabdoid tumor 1.300 1.1e-03
autosomal dominant Emery-Dreifuss muscul... 1.142 1.1e-04
Becker muscular dystrophy 1.119 8.7e-03
Breast cancer -1.100 1.2e-10
chronic lymphosyte leukemia -1.600 7.0e-10
Duchenne muscular dystrophy 1.339 2.1e-07
ductal carcinoma in situ -1.100 2.4e-02
fascioscapulohumeral muscular dystrophy 1.146 2.8e-05
gastric carcinoma 1.300 3.3e-02
group 3 medulloblastoma -1.400 1.8e-03
invasive ductal carcinoma -1.100 4.1e-03
juvenile dermatomyositis 1.462 2.4e-10
limb girdle muscular dystrophy 2A 1.249 2.1e-04
lung adenocarcinoma -1.200 1.5e-10
lung carcinoma -2.500 2.3e-23
medulloblastoma, large-cell -2.200 2.3e-05
non-small cell lung cancer -1.750 1.0e-14
oligodendroglioma -1.300 7.5e-04
osteosarcoma -1.367 3.6e-02
ovarian cancer -2.000 8.0e-07
pancreatic cancer 2.300 7.6e-04
primary pancreatic ductal adenocarcinoma 2.376 5.5e-04
psoriasis -1.100 3.2e-06
sarcoidosis -1.100 2.3e-02

Gene RIF (4)

AA Sequence

MPVTVTRTTITTTTTSSSGLGSPMIVGSPRALTQPLGLLRLLQLVSTCVAFSLVASVGAWTGSMGNWSMF      1 - 70
TWCFCFSVTLIILIVELCGLQARFPLSWRNFPITFACYAALFCLSASIIYPTTYVQFLSHGRSRDHAIAA     71 - 140
TFFSCIACVAYATEVAWTRARPGEITGYMATVPGLLKVLETFVACIIFAFISDPNLYQHQPALEWCVAVY    141 - 210
AICFILAAIAILLNLGECTNVLPIPFPSFLSGLALLSVLLYATALVLWPLYQFDEKYGGQPRRSRDVSCS    211 - 280
RSHAYYVCAWDRRLAVAILTAINLLAYVADLVHSAHLVFVKV                                281 - 322
//

Text Mined References (18)

PMID Year Title