Property Summary

NCBI Gene PubMed Count 32
PubMed Score 25.37
PubTator Score 27.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
acute quadriplegic myopathy -1.931 1.6e-05
atypical teratoid/rhabdoid tumor -1.100 8.8e-05
autosomal dominant Emery-Dreifuss muscul... -1.310 2.4e-04
Duchenne muscular dystrophy -1.380 1.3e-07
ependymoma 1.500 6.8e-03
gastric carcinoma -1.700 1.1e-02
group 3 medulloblastoma -1.400 1.3e-03
juvenile dermatomyositis -1.352 1.1e-08
lung adenocarcinoma -2.200 1.1e-09
lung carcinoma -4.000 3.2e-31
non-small cell lung cancer -4.613 7.6e-32
psoriasis -2.000 4.4e-55

Synonym

Accession Q96S96 Q5EVA1 Q8WW74 PEBP-4
Symbols CORK1
CORK-1
PEBP-4
hPEBP4
PRO4408
GWTM1933
HEL-S-300

Gene

PANTHER Protein Class (2)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (23)

AA Sequence

MGWTMRLVTAALLLGLMMVVTGDEDENSPCAHEALLDEDTLFCQGLEVFYPELGNIGCKVVPDCNNYRQK      1 - 70
ITSWMEPIVKFPGAVDGATYILVMVDPDAPSRAEPRQRFWRHWLVTDIKGADLKKGKIQGQELSAYQAPS     71 - 140
PPAHSGFHRYQFFVYLQEGKVISLLPKENKTRGSWKMDRFLNRFHLGEPEASTQFMTQNYQDSPTLQAPR    141 - 210
ERASEPKHKNQAEIAAC                                                         211 - 227
//

Text Mined References (32)

PMID Year Title