Property Summary

NCBI Gene PubMed Count 28
PubMed Score 22.53
PubTator Score 27.50

Knowledge Summary

Patent

No data available

Expression

Gene RIF (19)

PMID Text
27033522 PEBP4 is a secreted protein and has multiple functions, including a role in Akt phosphorylation.
25721211 Increased miR-15b expression in lung adenocarcinoma patients treated with cisplatin-based chemotherapy was correlated with low expression of PEBP4, decreased sensitivity to cisplatin and poor prognosis.
25038915 overexpression of PEBP4, which we show to be a target of miR-34a, reduces the sensitivity of lung cancer cells to cisplatin
24594691 concluded that hPEBP4, specifically expressed in rectal cancer cells, is associated with radioresistance of rectal cancer
24276246 in human breast cancer hPEBP4 is a novel and clinically relevant metastasis accelerator gene
23818363 Human PEBP4 expression correlates negatively with estrogen and progesterone receptors in endometrial carcinoma.
23451095 hPEBP4 knockdown potentiated the chemosensitization of the rituximab in B-cell lymphoma cells by regulating the expression of Bcl-xl, Cycline E, p21(waf/cip1) and p53 and the activation of caspase-3 and caspase-9.
22983920 PEBP4 enhanced cell proliferation and invasion ability and inhibited apoptosis. Decreased PEBP4 expression may play a role in the reduced invasion ability and increased apoptosis of the human non-small cell lung cancer cell line HCC827.
22801881 the independent predictive values of hPEBP4 in response of rectal cancer to preoperative radiotherapy, are reported.
22125029 The over-expression of PEBP4 protein may be related to the tumorigenesis, development, metastasis, and invasion of colorectal cancer.
More...

AA Sequence

MGWTMRLVTAALLLGLMMVVTGDEDENSPCAHEALLDEDTLFCQGLEVFYPELGNIGCKVVPDCNNYRQK      1 - 70
ITSWMEPIVKFPGAVDGATYILVMVDPDAPSRAEPRQRFWRHWLVTDIKGADLKKGKIQGQELSAYQAPS     71 - 140
PPAHSGFHRYQFFVYLQEGKVISLLPKENKTRGSWKMDRFLNRFHLGEPEASTQFMTQNYQDSPTLQAPR    141 - 210
ERASEPKHKNQAEIAAC                                                         211 - 227
//

Text Mined References (28)

PMID Year Title
27033522 2016 Phosphatidylethanolamine binding protein 4 (PEBP4) is a secreted protein and has multiple functions.
25721211 2015 miR-15b regulates cisplatin resistance and metastasis by targeting PEBP4 in human lung adenocarcinoma cells.
25038915 2014 Downregulation of PEBP4, a target of miR-34a, sensitizes drug-resistant lung cancer cells.
24839885 2014 A genome-wide association meta-analysis of preschool internalizing problems.
24594691 2014 Human phosphatidylethanolamine-binding protein 4 promoted the radioresistance of human rectal cancer by activating Akt in an ROS-dependent way.
24276246 2014 Phosphatidylethanolamine-binding protein 4 is associated with breast cancer metastasis through Src-mediated Akt tyrosine phosphorylation.
24159190 2014 Genome-wide association study on dimethylarginines reveals novel AGXT2 variants associated with heart rate variability but not with overall mortality.
23818363 Expression of hPEBP4 negatively correlates with estrogen and progesterone receptors in endometrial carcinoma.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23451095 2013 Silencing of human phosphatidylethanolamine-binding protein 4 enhances rituximab-induced death and chemosensitization in B-cell lymphoma.
More...