Property Summary

NCBI Gene PubMed Count 9
Grant Count 4
Funding $133,639.24
PubMed Score 12.30
PubTator Score 5.70

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96S95
Symbols CAMKIIN
CAM-KIIN

Gene

Gene RIF (5)

PMID Text
23545117 Mutant FUS-DeltaNLS increased calcium/calmodulin-dependent protein kinase II inhibitor 2 (CAMK2N2) at both mRNA and protein levels.
23153928 Murine double minute 2 (MDM2) protein levels were decreased in AD cells relative to control lymphoblasts, suggesting an impairment of FOXO3a degradation.
20487031 We show that CaMKII N beta expression is differentially regulated by novelty and contextual fear conditioning, providing further insight into molecular basis of fear LTM.
19586909 hCaMKIINbeta may play an important role in the regulation of tumor cell growth
9724800 Functional study of the rat homolog

AA Sequence

MSEILPYSEDKMGRFGADPEGSDLSFSCRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIEDDRIDDVLKG      1 - 70
MGEKPPSGV                                                                  71 - 79
//

Text Mined References (10)

PMID Year Title
23545117 2013 Genome wide array analysis indicates that an amyotrophic lateral sclerosis mutation of FUS causes an early increase of CAMK2N2 in vitro.
23153928 2013 Downregulation of extracellular signal-regulated kinase 1/2 activity by calmodulin KII modulates p21Cip1 levels and survival of immortalized lymphocytes from Alzheimer's disease patients.
22472876 2013 A mega-analysis of genome-wide association studies for major depressive disorder.
20487031 2010 Differential regulation of CaMKII inhibitor beta protein expression after exposure to a novel context and during contextual fear memory formation.
19586909 2009 Endogenous human CaMKII inhibitory protein suppresses tumor growth by inducing cell cycle arrest and apoptosis through down-regulation of the phosphatidylinositide 3-kinase/Akt/HDM2 pathway.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12531901 2003 RICS, a novel GTPase-activating protein for Cdc42 and Rac1, is involved in the beta-catenin-N-cadherin and N-methyl-D-aspartate receptor signaling.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11444830 2001 Molecular cloning and characterization of a novel calcium/calmodulin-dependent protein kinase II inhibitor from human dendritic cells.
9724800 1998 Characterization of a calmodulin kinase II inhibitor protein in brain.