Property Summary

NCBI Gene PubMed Count 9
PubMed Score 13.41
PubTator Score 5.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Synonym

Accession Q96S95
Symbols CAMKIIN
CAM-KIIN

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (5)

AA Sequence

MSEILPYSEDKMGRFGADPEGSDLSFSCRLQDTNSFFAGNQAKRPPKLGQIGRAKRVVIEDDRIDDVLKG      1 - 70
MGEKPPSGV                                                                  71 - 79
//

Text Mined References (10)

PMID Year Title