Property Summary

NCBI Gene PubMed Count 17
PubMed Score 102.37
PubTator Score 6.97

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.101 4.2e-07
astrocytic glioma 1.700 4.7e-03
ependymoma 1.800 8.2e-03
glioblastoma multiforme 1.100 2.6e-16
group 3 medulloblastoma 1.400 7.4e-03
lung adenocarcinoma 1.100 1.2e-03
malignant mesothelioma -1.100 5.6e-06
oligodendroglioma 1.100 4.3e-03
osteosarcoma -1.041 2.4e-03
ovarian cancer -1.900 1.0e-08
pancreatic ductal adenocarcinoma liver m... 1.730 1.1e-03
Pick disease -1.900 3.7e-07
progressive supranuclear palsy -1.500 4.9e-03
psoriasis -1.200 1.3e-03

Gene RIF (6)

AA Sequence

MAAAAAAAGAAGSAAPAAAAGAPGSGGAPSGSQGVLIGDRLYSGVLITLENCLLPDDKLRFTPSMSSGLD      1 - 70
TDTETDLRVVGCELIQAAGILLRLPQVAMATGQVLFQRFFYTKSFVKHSMEHVSMACVHLASKIEEAPRR     71 - 140
IRDVINVFHRLRQLRDKKKPVPLLLDQDYVNLKNQIIKAERRVLKELGFCVHVKHPHKIIVMYLQVLECE    141 - 210
RNQHLVQTSWNYMNDSLRTDVFVRFQPESIACACIYLAARTLEIPLPNRPHWFLLFGATEEEIQEICLKI    211 - 280
LQLYARKKVDLTHLEGEVEKRKHAIEEAKAQARGLLPGGTQVLDGTSGFSPAPKLVESPKEGKGSKPSPL    281 - 350
SVKNTKRRLEGAKKAKADSPVNGLPKGRESRSRSRSREQSYSRSPSRSASPKRRKSDSGSTSGGSKSQSR    351 - 420
SRSRSDSPPRQAPRSAPYKGSEIRGSRKSKDCKYPQKPHKSRSRSSSRSRSRSRERADNPGKYKKKSHYY    421 - 490
RDQRRERSRSYERTGRRYERDHPGHSRHRR                                            491 - 520
//

Text Mined References (26)

PMID Year Title