Property Summary

NCBI Gene PubMed Count 16
PubMed Score 94.99
PubTator Score 6.97

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
glioblastoma multiforme 347 2.5604202580896E-16
ovarian cancer 8492 1.02894020720201E-8
acute quadriplegic myopathy 1157 4.23604764747671E-7
Pick disease 1893 1.10487987239462E-6
malignant mesothelioma 3163 5.61606224732567E-6
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00110364282983767
lung adenocarcinoma 2714 0.00117548438659056
psoriasis 6685 0.00127387793508415
osteosarcoma 7933 0.00244447858992434
oligodendroglioma 2849 0.00426477762512819
astrocytic glioma 2241 0.00468296600653672
progressive supranuclear palsy 674 0.00610882911313762
ependymoma 2514 0.00703856111766123
group 3 medulloblastoma 2254 0.0074150553225571

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma -1.100 0.000
astrocytic glioma 1.700 0.005
ependymoma 1.900 0.007
oligodendroglioma 1.100 0.004
psoriasis -1.200 0.001
glioblastoma multiforme 1.100 0.000
osteosarcoma -1.041 0.002
group 3 medulloblastoma 1.400 0.007
acute quadriplegic myopathy 1.101 0.000
pancreatic ductal adenocarcinoma liver m... 1.730 0.001
lung adenocarcinoma 1.100 0.001
Pick disease -2.300 0.000
progressive supranuclear palsy -1.800 0.006
ovarian cancer -1.900 0.000

Synonym

Accession Q96S94 A0A024R072 A0A024R077 A0A0C4DGC4 A8K8A3 B1B152 F2Z3J5 Q5T2N5 Q5T2N6 Q6IQ12 Q7Z4Z8 Q8N3C9 Q8N3D5 Q8NHE3 Q8TEL0 Q96B00
Symbols CCNM
CCNS
PCEE
SB138
ANIA-6B
HLA-ISO
HCLA-ISO

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Chicken OMA EggNOG
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans EggNOG Inparanoid

Gene RIF (6)

PMID Text
25532805 Therefore, cyclin L2-mediated control of SAMHD1 levels in macrophages supports HIV-1 replication.
24218572 CDK10/cyclin M is a protein kinase that controls ETS2 degradation and is deficient in STAR syndrome.
18216018 CDK11(p110) interacts physically and functionally with cyclin Lalpha and -beta isoforms and SR proteins to regulate splicing.
17494991 Data show that a green fluorescent protein (GFP) fusion protein of cyclin L1, in contrast to cyclin L2, was not mobile within the nucleus of living COS7 cells.
14684736 represents a new member of the cyclin family, which might regulate the transcription and RNA processing of certain apoptosis-related factors
14623875 characterize cyclin L2 as a highly mobile component of nuclear speckles and suggest that DYRK1A may regulate splicing by phosphorylation of cyclin L2

AA Sequence

MAAAAAAAGAAGSAAPAAAAGAPGSGGAPSGSQGVLIGDRLYSGVLITLENCLLPDDKLRFTPSMSSGLD      1 - 70
TDTETDLRVVGCELIQAAGILLRLPQVAMATGQVLFQRFFYTKSFVKHSMEHVSMACVHLASKIEEAPRR     71 - 140
IRDVINVFHRLRQLRDKKKPVPLLLDQDYVNLKNQIIKAERRVLKELGFCVHVKHPHKIIVMYLQVLECE    141 - 210
RNQHLVQTSWNYMNDSLRTDVFVRFQPESIACACIYLAARTLEIPLPNRPHWFLLFGATEEEIQEICLKI    211 - 280
LQLYARKKVDLTHLEGEVEKRKHAIEEAKAQARGLLPGGTQVLDGTSGFSPAPKLVESPKEGKGSKPSPL    281 - 350
SVKNTKRRLEGAKKAKADSPVNGLPKGRESRSRSRSREQSYSRSPSRSASPKRRKSDSGSTSGGSKSQSR    351 - 420
SRSRSDSPPRQAPRSAPYKGSEIRGSRKSKDCKYPQKPHKSRSRSSSRSRSRSRERADNPGKYKKKSHYY    421 - 490
RDQRRERSRSYERTGRRYERDHPGHSRHRR                                            491 - 520
//

Text Mined References (25)

PMID Year Title
25532805 2015 Cyclin L2 is a critical HIV dependency factor in macrophages that controls SAMHD1 abundance.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24218572 2013 CDK10/cyclin M is a protein kinase that controls ETS2 degradation and is deficient in STAR syndrome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...