Tbio | Cyclin-L2 |
Involved in pre-mRNA splicing. May induce cell death, possibly by acting on the transcription and RNA processing of apoptosis-related factors.
The protein encoded by this gene belongs to the cyclin family. Through its interaction with several proteins, such as RNA polymerase II, splicing factors, and cyclin-dependent kinases, this protein functions as a regulator of the pre-mRNA splicing process, as well as in inducing apoptosis by modulating the expression of apoptotic and antiapoptotic proteins. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Aug 2011]
The protein encoded by this gene belongs to the cyclin family. Through its interaction with several proteins, such as RNA polymerase II, splicing factors, and cyclin-dependent kinases, this protein functions as a regulator of the pre-mRNA splicing process, as well as in inducing apoptosis by modulating the expression of apoptotic and antiapoptotic proteins. Alternatively spliced transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Aug 2011]
Comments
Disease | Target Count | P-value |
---|---|---|
glioblastoma multiforme | 347 | 2.5604202580896E-16 |
ovarian cancer | 8492 | 1.02894020720201E-8 |
acute quadriplegic myopathy | 1157 | 4.23604764747671E-7 |
Pick disease | 1893 | 1.10487987239462E-6 |
malignant mesothelioma | 3163 | 5.61606224732567E-6 |
pancreatic ductal adenocarcinoma liver metastasis | 1795 | 0.00110364282983767 |
lung adenocarcinoma | 2714 | 0.00117548438659056 |
psoriasis | 6685 | 0.00127387793508415 |
osteosarcoma | 7933 | 0.00244447858992434 |
oligodendroglioma | 2849 | 0.00426477762512819 |
astrocytic glioma | 2241 | 0.00468296600653672 |
progressive supranuclear palsy | 674 | 0.00610882911313762 |
ependymoma | 2514 | 0.00703856111766123 |
group 3 medulloblastoma | 2254 | 0.0074150553225571 |
Disease | log2 FC | p |
---|---|---|
malignant mesothelioma | -1.100 | 0.000 |
astrocytic glioma | 1.700 | 0.005 |
ependymoma | 1.900 | 0.007 |
oligodendroglioma | 1.100 | 0.004 |
psoriasis | -1.200 | 0.001 |
glioblastoma multiforme | 1.100 | 0.000 |
osteosarcoma | -1.041 | 0.002 |
group 3 medulloblastoma | 1.400 | 0.007 |
acute quadriplegic myopathy | 1.101 | 0.000 |
pancreatic ductal adenocarcinoma liver m... | 1.730 | 0.001 |
lung adenocarcinoma | 1.100 | 0.001 |
Pick disease | -2.300 | 0.000 |
progressive supranuclear palsy | -1.800 | 0.006 |
ovarian cancer | -1.900 | 0.000 |
Species | Source |
---|---|
Chimp | OMA EggNOG |
Macaque | OMA EggNOG Inparanoid |
Mouse | OMA EggNOG Inparanoid |
Rat | OMA EggNOG Inparanoid |
Dog | OMA EggNOG Inparanoid |
Cow | OMA EggNOG Inparanoid |
Chicken | OMA EggNOG |
Anole lizard | OMA Inparanoid |
Xenopus | OMA EggNOG Inparanoid |
C. elegans | EggNOG Inparanoid |
PMID | Text |
---|---|
25532805 | Therefore, cyclin L2-mediated control of SAMHD1 levels in macrophages supports HIV-1 replication. |
24218572 | CDK10/cyclin M is a protein kinase that controls ETS2 degradation and is deficient in STAR syndrome. |
18216018 | CDK11(p110) interacts physically and functionally with cyclin Lalpha and -beta isoforms and SR proteins to regulate splicing. |
17494991 | Data show that a green fluorescent protein (GFP) fusion protein of cyclin L1, in contrast to cyclin L2, was not mobile within the nucleus of living COS7 cells. |
14684736 | represents a new member of the cyclin family, which might regulate the transcription and RNA processing of certain apoptosis-related factors |
14623875 | characterize cyclin L2 as a highly mobile component of nuclear speckles and suggest that DYRK1A may regulate splicing by phosphorylation of cyclin L2 |
MAAAAAAAGAAGSAAPAAAAGAPGSGGAPSGSQGVLIGDRLYSGVLITLENCLLPDDKLRFTPSMSSGLD 1 - 70 TDTETDLRVVGCELIQAAGILLRLPQVAMATGQVLFQRFFYTKSFVKHSMEHVSMACVHLASKIEEAPRR 71 - 140 IRDVINVFHRLRQLRDKKKPVPLLLDQDYVNLKNQIIKAERRVLKELGFCVHVKHPHKIIVMYLQVLECE 141 - 210 RNQHLVQTSWNYMNDSLRTDVFVRFQPESIACACIYLAARTLEIPLPNRPHWFLLFGATEEEIQEICLKI 211 - 280 LQLYARKKVDLTHLEGEVEKRKHAIEEAKAQARGLLPGGTQVLDGTSGFSPAPKLVESPKEGKGSKPSPL 281 - 350 SVKNTKRRLEGAKKAKADSPVNGLPKGRESRSRSRSREQSYSRSPSRSASPKRRKSDSGSTSGGSKSQSR 351 - 420 SRSRSDSPPRQAPRSAPYKGSEIRGSRKSKDCKYPQKPHKSRSRSSSRSRSRSRERADNPGKYKKKSHYY 421 - 490 RDQRRERSRSYERTGRRYERDHPGHSRHRR 491 - 520 //
PMID | Year | Title |
---|---|---|
25532805 | 2015 | Cyclin L2 is a critical HIV dependency factor in macrophages that controls SAMHD1 abundance. |
25416956 | 2014 | A proteome-scale map of the human interactome network. |
24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. |
24218572 | 2013 | CDK10/cyclin M is a protein kinase that controls ETS2 degradation and is deficient in STAR syndrome. |
23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
22814378 | 2012 | N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB. |
22223895 | 2012 | Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features. |
21406692 | 2011 | System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. |
20068231 | 2010 | Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. |
19690332 | 2009 | Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. |
More... |