Property Summary

NCBI Gene PubMed Count 10
PubMed Score 2.00
PubTator Score 2.58

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96S82 D3DW57 Q96I03
Symbols TCBA1
BMSC-UbP

Gene

PDB

2DEN   2CWB  

 Compartment GO Term (0)

Gene RIF (2)

PMID Text
16731964 the solution NMR structure of the ubiquitin-associated domain of the human BMSC-UbP protein and its complex with ubiquitin
12644319 BMSC-UbP might play roles in regulation of BMSC function or cell differentiation through an evocator- and cell-specific pattern.

AA Sequence

MSLSDWHLAVKLADQPLTPKSILRLPETELGEYSLGGYSISFLKQLIAGKLQESVPDPELIDLIYCGRKL      1 - 70
KDDQTLDFYGIQPGSTVHVLRKSWPEPDQKPEPVDKVAAMREFRVLHTALHSSSSYREAVFKMLSNKESL     71 - 140
DQIIVATPGLSSDPIALGVLQDKDLFSVFADPNMLDTLVPAHPALVNAIVLVLHSVAGSAPMPGTDSSSR    141 - 210
SMPSSSYRDMPGGFLFEGLSDDEDDFHPNTRSTPSSSTPSSRPASLGYSGAAGPRPITQSELATALALAS    211 - 280
TPESSSHTPTPGTQGHSSGTSPMSSGVQSGTPITNDLFSQALQHALQASGQPSLQSQWQPQLQQLRDMGI    281 - 350
QDDELSLRALQATGGDIQAALELIFAGGAP                                            351 - 380
//

Text Mined References (18)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
18220336 2008 Combining protein-based IMAC, peptide-based IMAC, and MudPIT for efficient phosphoproteomic analysis.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
More...