Property Summary

NCBI Gene PubMed Count 7
PubMed Score 1.31
PubTator Score 5.00

Knowledge Summary

Patent

No data available

Gene RIF (2)

PMID Text
17984325 RRP17 is a component of the cellular machinery involved in regulated secretion within the heart and potential mediator of the endocrine influence of the heart on other tissues
17028781 RasL10B is a new member of Ras superfamily with tumor suppressor potential

AA Sequence

MVSTYRVAVLGARGVGKSAIVRQFLYNEFSEVCVPTTARRLYLPAVVMNGHVHDLQILDFPPISAFPVNT      1 - 70
LQEWADTCCRGLRSVHAYILVYDICCFDSFEYVKTIRQQILETRVIGTSETPIIIVGNKRDLQRGRVIPR     71 - 140
WNVSHLVRKTWKCGYVECSAKYNWHILLLFSELLKSVGCARCKHVHAALRFQGALRRNRCAIM           141 - 203
//

Text Mined References (8)

PMID Year Title
17984325 2007 Regulation of atrial natriuretic peptide secretion by a novel Ras-like protein.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
17028781 2006 Cloning and characterization of a novel small monomeric GTPase, RasL10B, with tumor suppressor potential.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.