Property Summary

NCBI Gene PubMed Count 9
PubMed Score 9.65
PubTator Score 4.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
acute myeloid leukemia 1.300 2.7e-02
adrenocortical carcinoma -1.773 1.9e-06
Breast cancer -1.500 2.9e-21
chronic rhinosinusitis -1.594 1.1e-02
gastric carcinoma 1.100 4.4e-02
group 4 medulloblastoma -1.100 2.5e-03
lung adenocarcinoma -1.300 6.7e-11
lung carcinoma -1.400 3.9e-07
medulloblastoma, large-cell -1.200 1.9e-02
Multiple Sclerosis 1.100 8.7e-03
non-small cell lung cancer -2.638 4.7e-24
ovarian cancer 1.300 1.7e-02
pancreatic cancer 1.200 8.8e-03
pituitary cancer -1.700 1.1e-04
primary pancreatic ductal adenocarcinoma 1.544 8.7e-03
psoriasis -1.300 6.1e-08
spina bifida -1.374 3.6e-02
ulcerative colitis 1.200 8.5e-06
urothelial carcinoma -1.300 2.1e-03

Gene RIF (1)

AA Sequence

MTGLLKRKFDQLDEDNSSVSSSSSSSGCQSRSCSPSSSVSRAWDSEEEGPWDQMPLPDRDFCGPRSFTPL      1 - 70
SILKRARRERPGRVAFDGITVFYFPRCQGFTSVPSRGGCTLGMALRHSACRRFSLAEFAQEQARARHEKL     71 - 140
RQRLKEEKLEMLQWKLSAAGVPQAEAGLPPVVDAIDDASVEEDLAVAVAGGRLEEVSFLQPYPARRRRAL    141 - 210
LRASGVRRIDREEKRELQALRQSREDCGCHCDRICDPETCSCSLAGIKCQMDHTAFPCGCCREGCENPMG    211 - 280
RVEFNQARVQTHFIHTLTRLQLEQEAESFRELEAPAQGSPPSPGEEALVPTFPLAKPPMNNELGDNSCSS    281 - 350
DMTDSSTASSSASGTSEAPDCPTHPGLPGPGFQPGVDDDSLARILSFSDSDFGGEEEEEEEGSVGNLDNL    351 - 420
SCFHPADIFGTSDPGGLASWTHSYSGCSFTSGVLDENANLDASCFLNGGLEGSREGSLPGTSVPPSMDAG    421 - 490
RSSSVDLSLSSCDSFELLQALPDYSLGPHYTSQKVSDSLDNIEAPHFPLPGLSPPGDASSCFLESLMGFS    491 - 560
EPAAEALDPFIDSQFEDTVPASLMEPVPV                                             561 - 589
//

Text Mined References (11)

PMID Year Title