Property Summary

NCBI Gene PubMed Count 9
Grant Count 2
Funding $177,692
PubMed Score 7.95
PubTator Score 4.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (19)

Disease log2 FC p
urothelial carcinoma -1.300 0.002
medulloblastoma, large-cell -1.200 0.019
adrenocortical carcinoma -1.773 0.000
primary pancreatic ductal adenocarcinoma 1.544 0.009
non-small cell lung cancer -2.638 0.000
Multiple Sclerosis 1.100 0.009
lung adenocarcinoma -1.900 0.000
sonic hedgehog group medulloblastoma -1.400 0.001
psoriasis -1.300 0.000
inflammatory breast cancer -2.200 0.000
lung carcinoma -1.400 0.000
spina bifida -1.374 0.036
gastric carcinoma 1.100 0.044
acute myeloid leukemia 1.300 0.027
ulcerative colitis 1.200 0.000
ovarian cancer 1.300 0.017
pituitary cancer -1.700 0.000
chronic rhinosinusitis -1.594 0.011
pancreatic cancer 1.200 0.009

Gene RIF (1)

PMID Text
23292452 Three candidate tumor-suppressor genes, SEMA3B, AXUD1 and GNAT1 may be involved in oral squamous cell carcinoma.

AA Sequence

MTGLLKRKFDQLDEDNSSVSSSSSSSGCQSRSCSPSSSVSRAWDSEEEGPWDQMPLPDRDFCGPRSFTPL      1 - 70
SILKRARRERPGRVAFDGITVFYFPRCQGFTSVPSRGGCTLGMALRHSACRRFSLAEFAQEQARARHEKL     71 - 140
RQRLKEEKLEMLQWKLSAAGVPQAEAGLPPVVDAIDDASVEEDLAVAVAGGRLEEVSFLQPYPARRRRAL    141 - 210
LRASGVRRIDREEKRELQALRQSREDCGCHCDRICDPETCSCSLAGIKCQMDHTAFPCGCCREGCENPMG    211 - 280
RVEFNQARVQTHFIHTLTRLQLEQEAESFRELEAPAQGSPPSPGEEALVPTFPLAKPPMNNELGDNSCSS    281 - 350
DMTDSSTASSSASGTSEAPDCPTHPGLPGPGFQPGVDDDSLARILSFSDSDFGGEEEEEEEGSVGNLDNL    351 - 420
SCFHPADIFGTSDPGGLASWTHSYSGCSFTSGVLDENANLDASCFLNGGLEGSREGSLPGTSVPPSMDAG    421 - 490
RSSSVDLSLSSCDSFELLQALPDYSLGPHYTSQKVSDSLDNIEAPHFPLPGLSPPGDASSCFLESLMGFS    491 - 560
EPAAEALDPFIDSQFEDTVPASLMEPVPV                                             561 - 589
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24564958 2014 Variability in the common genetic architecture of social-communication spectrum phenotypes during childhood and adolescence.
23292452 2013 Screening of candidate tumor-suppressor genes in 3p21.3 and investigation of the methylation of gene promoters in oral squamous cell carcinoma.
22321011 Protein phosphatase 1? interacting proteins in the human brain.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17726538 2007 Characterization of a family of novel cysteine- serine-rich nuclear proteins (CSRNP).
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...