Property Summary

NCBI Gene PubMed Count 9
PubMed Score 7.95
PubTator Score 4.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Cardiomyopathy, Dilated 47
Disease Target Count P-value
non-small cell lung cancer 2798 4.71504963517063E-24
lung adenocarcinoma 2714 1.81598014216091E-12
inflammatory breast cancer 404 3.09898633598635E-10
psoriasis 6685 6.07519708405E-8
lung carcinoma 2844 3.87091160431088E-7
adrenocortical carcinoma 1427 1.90755285703362E-6
ulcerative colitis 2087 8.52830227613407E-6
pituitary cancer 1972 1.08233532334789E-4
sonic hedgehog group medulloblastoma 1482 5.22925631279538E-4
urothelial carcinoma 318 0.00206692206028217
Multiple Sclerosis 498 0.00866667204384447
primary pancreatic ductal adenocarcinoma 1271 0.00872732180198239
pancreatic cancer 2300 0.00880601889688516
chronic rhinosinusitis 512 0.0109628539464705
ovarian cancer 8492 0.0165513006529166
medulloblastoma, large-cell 6234 0.0187018430880994
acute myeloid leukemia 785 0.0265523687125971
spina bifida 1064 0.035817889435841
gastric carcinoma 832 0.0436802042538443
Disease Target Count Z-score Confidence
Root resorption 21 4.02 2.0

Expression

  Differential Expression (19)

Disease log2 FC p
urothelial carcinoma -1.300 0.002
medulloblastoma, large-cell -1.200 0.019
adrenocortical carcinoma -1.773 0.000
primary pancreatic ductal adenocarcinoma 1.544 0.009
non-small cell lung cancer -2.638 0.000
Multiple Sclerosis 1.100 0.009
lung adenocarcinoma -1.900 0.000
sonic hedgehog group medulloblastoma -1.400 0.001
psoriasis -1.300 0.000
inflammatory breast cancer -2.200 0.000
lung carcinoma -1.400 0.000
spina bifida -1.374 0.036
gastric carcinoma 1.100 0.044
acute myeloid leukemia 1.300 0.027
ulcerative colitis 1.200 0.000
ovarian cancer 1.300 0.017
pituitary cancer -1.700 0.000
chronic rhinosinusitis -1.594 0.011
pancreatic cancer 1.200 0.009

Synonym

Accession Q96S65 Q69YY5 CSRNP-1
Symbols AXUD1
URAX1
TAIP-3
CSRNP-1
FAM130B

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid

 GWAS Trait (1)

Gene RIF (1)

PMID Text
23292452 Three candidate tumor-suppressor genes, SEMA3B, AXUD1 and GNAT1 may be involved in oral squamous cell carcinoma.

AA Sequence

MTGLLKRKFDQLDEDNSSVSSSSSSSGCQSRSCSPSSSVSRAWDSEEEGPWDQMPLPDRDFCGPRSFTPL      1 - 70
SILKRARRERPGRVAFDGITVFYFPRCQGFTSVPSRGGCTLGMALRHSACRRFSLAEFAQEQARARHEKL     71 - 140
RQRLKEEKLEMLQWKLSAAGVPQAEAGLPPVVDAIDDASVEEDLAVAVAGGRLEEVSFLQPYPARRRRAL    141 - 210
LRASGVRRIDREEKRELQALRQSREDCGCHCDRICDPETCSCSLAGIKCQMDHTAFPCGCCREGCENPMG    211 - 280
RVEFNQARVQTHFIHTLTRLQLEQEAESFRELEAPAQGSPPSPGEEALVPTFPLAKPPMNNELGDNSCSS    281 - 350
DMTDSSTASSSASGTSEAPDCPTHPGLPGPGFQPGVDDDSLARILSFSDSDFGGEEEEEEEGSVGNLDNL    351 - 420
SCFHPADIFGTSDPGGLASWTHSYSGCSFTSGVLDENANLDASCFLNGGLEGSREGSLPGTSVPPSMDAG    421 - 490
RSSSVDLSLSSCDSFELLQALPDYSLGPHYTSQKVSDSLDNIEAPHFPLPGLSPPGDASSCFLESLMGFS    491 - 560
EPAAEALDPFIDSQFEDTVPASLMEPVPV                                             561 - 589
//

Text Mined References (11)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24564958 2014 Variability in the common genetic architecture of social-communication spectrum phenotypes during childhood and adolescence.
23292452 2013 Screening of candidate tumor-suppressor genes in 3p21.3 and investigation of the methylation of gene promoters in oral squamous cell carcinoma.
22321011 Protein phosphatase 1? interacting proteins in the human brain.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17726538 2007 Characterization of a family of novel cysteine- serine-rich nuclear proteins (CSRNP).
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...