Property Summary

NCBI Gene PubMed Count 57
Grant Count 48
R01 Count 23
Funding $3,056,312.59
PubMed Score 47.90
PubTator Score 54.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Multiple myeloma 1.016 0.016
esophageal adenocarcinoma -2.300 0.021
psoriasis 2.100 0.000
osteosarcoma 1.212 0.000
Breast cancer 3.200 0.027
group 4 medulloblastoma 1.100 0.017
lung adenocarcinoma 1.609 0.000
spina bifida -1.347 0.049
Pick disease -1.300 0.001
invasive ductal carcinoma 1.200 0.002

Gene RIF (35)

PMID Text
27049080 RanBP9 is positively expressed in bone tumor tissues and cell strains.
26977028 Loss of RanBPM expression may play an important role in gastric cancer tumor development and metastasis. Reduced RanBPM expression is also associated with chemoresistance of gastric cancer cells.
25900136 RanBPM was found to enhance Zta-dependent transcriptional activity via the inhibition of Zta sumoylation.
25659156 these analyses reveal that RanBPM subcellular localization results from the combined effects of several elements that either confer direct transport through the nucleocytoplasmic transport machinery
25482375 association analyses between RANBP9 variants and the risk of schizophrenia were conducted, however no significant association was identified.
25024339 RanBP9 relocates APP intracellular domain to Tip60-enriched nuclear speckles and prevented the formation of nuclear spots formation; results place RanBP9 as an important player in the multiple steps of AbetaPP signaling
24254706 RanBP9 transgene overexpression causes early synaptic deficits, impaired learning and accelerates amyloid plaque accumulation.
23928309 RanBPM acts as a negative regulator of BLT2 signaling to attenuate BLT2-mediated cell motility
23926111 COPS5 is a novel RanBP9-binding protein that increases APP processing and Abeta generation by stabilizing RanBP9 protein levels
22223749 Data indicate that RanBP9 simultaneously inhibits cell-adhesive processes and enhances Abeta generation by accelerating APP, LRP, and beta1-integrin endocytosis.
More...

AA Sequence

MSGQPPPPPPQQQQQQQQLSPPPPAALAPVSGVVLPAPPAVSAGSSPAGSPGGGAGGEGLGAAAAALLLH      1 - 70
PPPPPPPATAAPPPPPPPPPPPASAAAPASGPPAPPGLAAGPGPAGGAPTPALVAGSSAAAPFPHGDSAL     71 - 140
NEQEKELQRRLKRLYPAVDEQETPLPRSWSPKDKFSYIGLSQNNLRVHYKGHGKTPKDAASVRATHPIPA    141 - 210
ACGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDV    211 - 280
IGCCVNLINNTCFYTKNGHSLGIAFTDLPPNLYPTVGLQTPGEVVDANFGQHPFVFDIEDYMREWRTKIQ    281 - 350
AQIDRFPIGDREGEWQTMIQKMVSSYLVHHGYCATAEAFARSTDQTVLEELASIKNRQRIQKLVLAGRMG    351 - 420
EAIETTQQLYPSLLERNPNLLFTLKVRQFIEMVNGTDSEVRCLGGRSPKSQDSYPVSPRPFSSPSMSPSH    421 - 490
GMNIHNLASGKGSTAHFSGFESCSNGVISNKAHQSYCHSNKHQSSNLNVPELNSINMSRSQQVNNFTSND    491 - 560
VDMETDHYSNGVGETSSNGFLNGSSKHDHEMEDCDTEMEVDSSQLRRQLCGGSQAAIERMIHFGRELQAM    561 - 630
SEQLRRDCGKNTANKKMLKDAFSLLAYSDPWNSPVGNQLDPIQREPVCSALNSAILETHNLPKQPPLALA    631 - 700
MGQATQCLGLMARSGIGSCAFATVEDYLH                                             701 - 729
//

Text Mined References (66)

PMID Year Title
27049080 Expression of cartilage antitumor component RanBP9 in osteosarcoma.
26977028 2016 Reduced RanBPM Expression Is Associated with Distant Metastasis in Gastric Cancer and Chemoresistance.
25900136 2015 RanBPM regulates Zta-mediated transcriptional activity in Epstein-Barr virus.
25659156 2015 Characterization of RanBPM molecular determinants that control its subcellular localization.
25482375 2015 Investigating the potential genetic association between RANBP9 polymorphisms and the risk of schizophrenia.
25024339 2014 RanBP9 modulates AICD localization and transcriptional activity via direct interaction with Tip60.
24254706 2014 RanBP9 overexpression down-regulates phospho-cofilin, causes early synaptic deficits and impaired learning, and accelerates accumulation of amyloid plaques in the mouse brain.
23928309 2013 RanBPM protein acts as a negative regulator of BLT2 receptor to attenuate BLT2-mediated cell motility.
23926111 2013 COPS5 (Jab1) protein increases ? site processing of amyloid precursor protein and amyloid ? peptide generation by stabilizing RanBP9 protein levels.
23840749 2013 MOR is not enough: identification of novel mu-opioid receptor interacting proteins using traditional and modified membrane yeast two-hybrid screens.
More...