Property Summary

NCBI Gene PubMed Count 64
PubMed Score 53.02
PubTator Score 54.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count
Schizophrenia 1160
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7
Disease Target Count Z-score Confidence
Breast cancer 3578 0.0 0.0270162221104319

Expression

  Differential Expression (10)

Disease log2 FC p
Breast cancer 3.200 2.7e-02
esophageal adenocarcinoma -1.600 2.0e-02
group 4 medulloblastoma 1.100 1.7e-02
invasive ductal carcinoma 1.200 2.1e-03
lung adenocarcinoma 1.609 2.0e-06
Multiple myeloma 1.016 1.6e-02
osteosarcoma 1.212 8.6e-05
Pick disease -1.300 1.0e-03
psoriasis 1.300 1.7e-06
spina bifida -1.347 4.9e-02

Protein-protein Interaction (1)

Gene RIF (41)

AA Sequence

MSGQPPPPPPQQQQQQQQLSPPPPAALAPVSGVVLPAPPAVSAGSSPAGSPGGGAGGEGLGAAAAALLLH      1 - 70
PPPPPPPATAAPPPPPPPPPPPASAAAPASGPPAPPGLAAGPGPAGGAPTPALVAGSSAAAPFPHGDSAL     71 - 140
NEQEKELQRRLKRLYPAVDEQETPLPRSWSPKDKFSYIGLSQNNLRVHYKGHGKTPKDAASVRATHPIPA    141 - 210
ACGIYYFEVKIVSKGRDGYMGIGLSAQGVNMNRLPGWDKHSYGYHGDDGHSFCSSGTGQPYGPTFTTGDV    211 - 280
IGCCVNLINNTCFYTKNGHSLGIAFTDLPPNLYPTVGLQTPGEVVDANFGQHPFVFDIEDYMREWRTKIQ    281 - 350
AQIDRFPIGDREGEWQTMIQKMVSSYLVHHGYCATAEAFARSTDQTVLEELASIKNRQRIQKLVLAGRMG    351 - 420
EAIETTQQLYPSLLERNPNLLFTLKVRQFIEMVNGTDSEVRCLGGRSPKSQDSYPVSPRPFSSPSMSPSH    421 - 490
GMNIHNLASGKGSTAHFSGFESCSNGVISNKAHQSYCHSNKHQSSNLNVPELNSINMSRSQQVNNFTSND    491 - 560
VDMETDHYSNGVGETSSNGFLNGSSKHDHEMEDCDTEMEVDSSQLRRQLCGGSQAAIERMIHFGRELQAM    561 - 630
SEQLRRDCGKNTANKKMLKDAFSLLAYSDPWNSPVGNQLDPIQREPVCSALNSAILETHNLPKQPPLALA    631 - 700
MGQATQCLGLMARSGIGSCAFATVEDYLH                                             701 - 729
//

Text Mined References (73)

PMID Year Title