Property Summary

NCBI Gene PubMed Count 21
Grant Count 2
Funding $318,341
PubMed Score 327.95
PubTator Score 14.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
osteosarcoma -1.027 0.000
ovarian cancer 1.100 0.013

Synonym

Accession Q96S55 B2RDB0 Q53EP6 Q59ET8 Q5W0E2 Q5W0E4 Q8WV26 Q9H681 Q9NRJ6
Symbols WHIP
bA420G6.2

Gene

 Grant Application (2)

PDB

3VHS   3VHT  

Gene RIF (8)

PMID Text
25139235 results suggest that WRNIP1 functions upstream of Poleta in the response to UV irradiation
23110726 Depletion of Werner helicase interacting protein 1 (WRNIP1) by siRNA enhances HIV-1 Tat activation of HIV-1 LTR, which is not the results of increased Tat expression and release of CDK9/CCNT1 from 7SK snRNP, and activation of NF-kappaB
22209848 Mutated WRNIP1 with a deleted ATPase domain or with mutations in lysine residues accumulated in laser light irradiated sites, suggesting that the ATPase domain of WRNIP1 and ubiquitination of WRNIP1 are dispensable for the accumulation.
20676042 WHIP was identified as a partner/component of the nuclear envelope/nuclear pore complex (NPC) and set forth to investigate a role for the protein positioned at the NPC.
19556710 Data show that that WRNIP1 interacts physically with RAD18 and interferes with the binding of RAD18 to forked DNA and to template/primer DNA.
18842586 analysis of the composite and regulated topography of Wrnip1 in the human nucleus highlights its potential role in replication and other nuclear transactions
17550899 Werner helicase-interacting protein 1 binds polyubiquitin via its zinc finger domain
15670210 These results indicate that WRNIP1 functions as a modulator for initiation or restart events during pol delta-mediated DNA synthesis and that its ATPase activity is utilized to sense DNA ends and to regulate the extent of stimulation.

AA Sequence

MEVSGPEDDPFLSQLHQVQCPVCQQMMPAAHINSHLDRCLLLHPAGHAEPAAGSHRAGERAKGPSPPGAK      1 - 70
RRRLSESSALKQPATPTAAESSEGEGEEGDDGGETESRESYDAPPTPSGARLIPDFPVARSSSPGRKGSG     71 - 140
KRPAAAAAAGSASPRSWDEAEAQEEEEAVGDGDGDGDADADGEDDPGHWDADAAEAATAFGASGGGRPHP    141 - 210
RALAAEEIRQMLQGKPLADTMRPDTLQDYFGQSKAVGQDTLLRSLLETNEIPSLILWGPPGCGKTTLAHI    211 - 280
IASNSKKHSIRFVTLSATNAKTNDVRDVIKQAQNEKSFFKRKTILFIDEIHRFNKSQQDTFLPHVECGTI    281 - 350
TLIGATTENPSFQVNAALLSRCRVIVLEKLPVEAMVTILMRAINSLGIHVLDSSRPTDPLSHSSNSSSEP    351 - 420
AMFIEDKAVDTLAYLSDGDARAGLNGLQLAVLARLSSRKMFCKKSGQSYSPSRVLITENDVKEGLQRSHI    421 - 490
LYDRAGEEHYNCISALHKSMRGSDQNASLYWLARMLEGGEDPLYVARRLVRFASEDIGLADPSALTQAVA    491 - 560
AYQGCHFIGMPECEVLLAQCVVYFARAPKSIEVYSAYNNVKACLRNHQGPLPPVPLHLRNAPTRLMKDLG    561 - 630
YGKGYKYNPMYSEPVDQEYLPEELRGVDFFKQRRC                                       631 - 665
//

Text Mined References (32)

PMID Year Title
25139235 2014 WRNIP1 functions upstream of DNA polymerase ? in the UV-induced DNA damage response.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24270157 2013 A quantitative telomeric chromatin isolation protocol identifies different telomeric states.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22209848 2012 WRNIP1 accumulates at laser light irradiated sites rapidly via its ubiquitin-binding zinc finger domain and independently from its ATPase domain.
21903422 2011 Mapping a dynamic innate immunity protein interaction network regulating type I interferon production.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20676042 2010 The discovery of a Werner Helicase Interacting Protein (WHIP) association with the nuclear pore complex.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
More...