Property Summary

NCBI Gene PubMed Count 18
PubMed Score 17.70
PubTator Score 7.67

Knowledge Summary

Patent (3,312)

Expression

  Differential Expression (10)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.100 1.4e-03
breast carcinoma 1.100 1.2e-14
ductal carcinoma in situ 1.100 2.9e-04
glioblastoma 1.100 2.3e-06
group 3 medulloblastoma 1.300 7.0e-04
invasive ductal carcinoma 1.400 2.8e-03
medulloblastoma, large-cell 1.700 6.0e-06
osteosarcoma -1.698 1.2e-06
ovarian cancer 1.100 1.3e-04
pediatric high grade glioma 1.200 5.5e-07

Protein-protein Interaction (4)

Gene RIF (5)

AA Sequence

MAAARATTPADGEEPAPEAEALAAARERSSRFLSGLELVKQGAEARVFRGRFQGRAAVIKHRFPKGYRHP      1 - 70
ALEARLGRRRTVQEARALLRCRRAGISAPVVFFVDYASNCLYMEEIEGSVTVRDYIQSTMETEKTPQGLS     71 - 140
NLAKTIGQVLARMHDEDLIHGDLTTSNMLLKPPLEQLNIVLIDFGLSFISALPEDKGVDLYVLEKAFLST    141 - 210
HPNTETVFEAFLKSYSTSSKKARPVLKKLDEVRLRGRKRSMVG                               211 - 253
//

Text Mined References (25)

PMID Year Title