Property Summary

NCBI Gene PubMed Count 16
PubMed Score 16.80
PubTator Score 7.67

Knowledge Summary

Patent (3,312)

Expression

  Differential Expression (10)

Disease log2 FC p
osteosarcoma -1.698 0.000
glioblastoma 1.300 0.000
group 4 medulloblastoma 1.500 0.000
atypical teratoid / rhabdoid tumor 1.100 0.001
medulloblastoma, large-cell 1.700 0.000
pediatric high grade glioma 1.200 0.000
breast carcinoma 1.100 0.000
ductal carcinoma in situ 1.100 0.000
invasive ductal carcinoma 1.400 0.003
ovarian cancer 1.100 0.000

Synonym

Accession Q96S44 B3KU44 Q3T977 Q5JZ01 Q6NZ60 Q96FM7 Q9NQE6
Symbols PRPK
BUD32
Nori-2
Nori-2p
dJ101A2
C20orf64

Gene

PANTHER Protein Class (3)

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 Collection (1)

Gene RIF (4)

PMID Text
24351856 In a study addressing genetic, social, and environmental contributors of chronic kidney disease with tubulointerstitial damages in Sri Lanka, TP53RK was not confirmed to be genetically significant.
20677014 Observational study of gene-disease association. (HuGE Navigator)
17712528 activation of PRPK is mediated by another kinase, Akt/PKB, which phosphorylates PRPK at Ser250
16600182 A Small Ras-like GTPase protein Ray was indicated to modulate p53 transcriptional activity of PRPK.

AA Sequence

MAAARATTPADGEEPAPEAEALAAARERSSRFLSGLELVKQGAEARVFRGRFQGRAAVIKHRFPKGYRHP      1 - 70
ALEARLGRRRTVQEARALLRCRRAGISAPVVFFVDYASNCLYMEEIEGSVTVRDYIQSTMETEKTPQGLS     71 - 140
NLAKTIGQVLARMHDEDLIHGDLTTSNMLLKPPLEQLNIVLIDFGLSFISALPEDKGVDLYVLEKAFLST    141 - 210
HPNTETVFEAFLKSYSTSSKKARPVLKKLDEVRLRGRKRSMVG                               211 - 253
//

Text Mined References (23)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24351856 2014 An integrative study of the genetic, social and environmental determinants of chronic kidney disease characterized by tubulointerstitial damages in the North Central Region of Sri Lanka.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23414517 2013 A human skeletal muscle interactome centered on proteins involved in muscular dystrophies: LGMD interactome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22912744 2012 The human EKC/KEOPS complex is recruited to Cullin2 ubiquitin ligases by the human tumour antigen PRAME.
21269460 2011 Initial characterization of the human central proteome.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19369195 2009 Large-scale proteomics analysis of the human kinome.
More...