Property Summary

NCBI Gene PubMed Count 84
Grant Count 18
R01 Count 12
Funding $1,459,041.55
PubMed Score 930.29
PubTator Score 215.36

Knowledge Summary

Patent

No data available

Expression

 GO Component (1)

Gene RIF (79)

PMID Text
26427715 The MSX2 controls mesendoderm lineage commitment by simultaneous suppression of SOX2 and induction of NODAL expression through direct binding and activation of the Nodal promoter.
26358078 Low expressions of NODAL is associated with lymph node metastasis in colorectal cancer.
26289399 Nodal is expressed in in male germ cells but not in Sertoli cells, whereas its receptors were detected in both, suggesting that NODAL plays a regulatory role in Sertoli cells and germ cells via a paracrine and autocrine pathway, respectively.
26226633 During a maturation phase, a fast acting NODAL loop stimulates its own activity and temporarily inhibits BMP signaling. During the stabilization phase, a slow acting NODAL loop, involving WNTs re-establishes BMP signaling and the pluripotency circuitry.
25766327 we found that Kl treatment impairs Nodal mRNA expression and Fgf9-mediated Nanos2 induction, reinforcing the antagonistic effect of these two growth factors on the meiotic fate of male germ cells
25708930 Nodal expression marks a subtype of human pancreatic ductal adenocarcinoma with unfavorable prognosis
25672326 The expression of lefty in RCC cells was lower than that in adjacent non-tumor cells, which may result in the overexpression of nodal, thereby promoting the growth of RCC.
25670856 Inhibition of activin/nodal signaling leads to formation of extravillous trophoblast, whereas loss of activin/nodal inhibition leads to the formation of syncytiotrophoblasts
25603319 our studies provide mechanistic insights into Nodal signaling and Nodal inhibition with Cerberus and highlight the potential value of Cerberus as anti-Nodal therapeutic.
25557170 Nodal induces signal transduction through the Smad2/3-dependent pathway in vitro. Results that Nodal promotes pancreatic cancer cell migration and invasion and induces epithelial-mesenchymal transition.
More...

AA Sequence

MHAHCLPFLLHAWWALLQAGAATVATALLRTRGQPSSPSPLAYMLSLYRDPLPRADIIRSLQAEDVAVDG      1 - 70
QNWTFAFDFSFLSQQEDLAWAELRLQLSSPVDLPTEGSLAIEIFHQPKPDTEQASDSCLERFQMDLFTVT     71 - 140
LSQVTFSLGSMVLEVTRPLSKWLKHPGALEKQMSRVAGECWPRPPTPPATNVLLMLYSNLSQEQRQLGGS    141 - 210
TLLWEAESSWRAQEGQLSWEWGKRHRRHHLPDRSQLCRKVKFQVDFNLIGWGSWIIYPKQYNAYRCEGEC    211 - 280
PNPVGEEFHPTNHAYIQSLLKRYQPHRVPSTCCAPVKTKPLSMLYVDNGRVLLDHHKDMIVEECGCL       281 - 347
//

Text Mined References (85)

PMID Year Title
26791244 2016 Keeping a lid on nodal: transcriptional and translational repression of nodal signalling.
26427715 2015 MSX2 mediates entry of human pluripotent stem cells into mesendoderm by simultaneously suppressing SOX2 and activating NODAL signaling.
26358078 2016 Aldehyde Dehydragenase 1 and Nodal as Significant Prognostic Markers in Colorectal Cancer.
26289399 NODAL secreted by male germ cells regulates the proliferation and function of human Sertoli cells from obstructive azoospermia and nonobstructive azoospermia patients.
26226633 2015 BMP Inhibition in Seminomas Initiates Acquisition of Pluripotency via NODAL Signaling Resulting in Reprogramming to an Embryonal Carcinoma.
25766327 2015 Fgf9 inhibition of meiotic differentiation in spermatogonia is mediated by Erk-dependent activation of Nodal-Smad2/3 signaling and is antagonized by Kit Ligand.
25708930 Increased expression of Nodal correlates with reduced patient survival in pancreatic cancer.
25672326 2015 Nodal activates smad and extracellular signal-regulated kinases 1/2 pathways promoting renal cell carcinoma proliferation.
25670856 2015 Activin/nodal signaling switches the terminal fate of human embryonic stem cell-derived trophoblasts.
25603319 2015 Human Cerberus prevents nodal-receptor binding, inhibits nodal signaling, and suppresses nodal-mediated phenotypes.
More...