Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.69
PubTator Score 4.19

Knowledge Summary

Patent (523)

TINX Plot

  Disease (2)

Disease Target Count P-value
ovarian cancer 8520 3.3e-05
lung cancer 4740 9.4e-04
diabetes mellitus 1728 1.0e-03
Pick disease 1894 4.1e-03
medulloblastoma, large-cell 6241 6.3e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0

Expression

  Differential Expression (5)

Disease log2 FC p
diabetes mellitus -1.100 1.0e-03
lung cancer 1.400 9.4e-04
medulloblastoma, large-cell -1.200 6.3e-03
ovarian cancer 2.000 3.3e-05
Pick disease -1.200 4.1e-03

Gene RIF (3)

AA Sequence

MTSYRERSADLARFYTVTEPQRHPRGYTVYKVTARVVSRRNPEDVQEIIVWKRYSDFKKLHKELWQIHKN      1 - 70
LFRHSELFPPFAKGIVFGRFDETVIEERRQCAEDLLQFSANIPALYNSKQLEDFFKGGIINDSSELIGPA     71 - 140
EAHSDSLIDTFPECSTEGFSSDSDLVSLTVDVDSLAELDDGMASNQNSPIRTFGLNLSSDSSALGAVASD    141 - 210
SEQSKTEEERESRSLFPGSLKPKLGKRDYLEKAGELIKLALKKEEEDDYEAASDFYRKGVDLLLEGVQGE    211 - 280
SSPTRREAVKRRTAEYLMRAESISSLYGKPQLDDVSQPPGSLSSRPLWNLRSPAEELKAFRVLGVIDKVL    281 - 350
LVMDTRTEQTFILKGLRKSSEYSRNRKTIIPRCVPNMVCLHKYIISEESVFLVLQHAEGGKLWSYISKFL    351 - 420
NRSPEESFDIKEVKKPTLAKVHLQQPTSSPQDSSSFESRGSDGGSMLKALPLKSSLTPSSQDDSNQEDDG    421 - 490
QDSSPKWPDSGSSSEEECTTSYLTLCNEYGQEKIEPGSLNEEPFMKTEGNGVDTKAIKSFPAHLAADSDS    491 - 560
PSTQLRAHELKFFPNDDPEAVSSPRTSDSLSRSKNSPMEFFRIDSKDSASELLGLDFGEKLYSLKSEPLK    561 - 630
PFFTLPDGDSASRSFNTSESKVEFKAQDTISRGSDDSVPVISFKDAAFDDVSGTDEGRPDLLVNLPGELE    631 - 700
STREAAAMGPTKFTQTNIGIIENKLLEAPDVLCLRLSTEQCQAHEEKGIEELSDPSGPKSYSITEKHYAQ    701 - 770
EDPRMLFVAAVDHSSSGDMSLLPSSDPKFQGLGVVESAVTANNTEESLFRICSPLSGANEYIASTDTLKT    771 - 840
EEVLLFTDQTDDLAKEEPTSLFQRDSETKGESGLVLEGDKEIHQIFEDLDKKLALASRFYIPEGCIQRWA    841 - 910
AEMVVALDALHREGIVCRDLNPNNILLNDRGHIQLTYFSRWSEVEDSCDSDAIERMYCAPEVGAITEETE    911 - 980
ACDWWSLGAVLFELLTGKTLVECHPAGINTHTTLNMPECVSEEARSLIQQLLQFNPLERLGAGVAGVEDI    981 - 1050
KSHPFFTPVDWAELMR                                                         1051 - 1066
//

Text Mined References (20)

PMID Year Title