Property Summary

Ligand Count 251
NCBI Gene PubMed Count 80
PubMed Score 306.69
PubTator Score 187.69

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Acute kidney injury 70 0.0 0.0
Renal hypouricemia 2 0.0 0.0
Disease Target Count
Hyperuricemia 47
Chronic gouty arthritis 4
Disease Target Count P-value
ovarian cancer 8520 1.4e-07
osteosarcoma 7950 3.5e-06
medulloblastoma, large-cell 6241 5.8e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Gout 104 6.445 3.2
Disease Target Count Z-score Confidence
Kidney disease 430 3.979 2.0
Neurotic disorder 9 3.118 1.6
Disease Target Count
Familial renal hypouricemia 2

Expression

  Differential Expression (3)

Disease log2 FC p
medulloblastoma, large-cell 1.300 5.8e-04
osteosarcoma 1.340 3.5e-06
ovarian cancer 1.300 1.4e-07

Gene RIF (66)

AA Sequence

MAFSELLDLVGGLGRFQVLQTMALMVSIMWLCTQSMLENFSAAVPSHRCWAPLLDNSTAQASILGSLSPE      1 - 70
ALLAISIPPGPNQRPHQCRRFRQPQWQLLDPNATATSWSEADTEPCVDGWVYDRSIFTSTIVAKWNLVCD     71 - 140
SHALKPMAQSIYLAGILVGAAACGPASDRFGRRLVLTWSYLQMAVMGTAAAFAPAFPVYCLFRFLLAFAV    141 - 210
AGVMMNTGTLLMEWTAARARPLVMTLNSLGFSFGHGLTAAVAYGVRDWTLLQLVVSVPFFLCFLYSWWLA    211 - 280
ESARWLLTTGRLDWGLQELWRVAAINGKGAVQDTLTPEVLLSAMREELSMGQPPASLGTLLRMPGLRFRT    281 - 350
CISTLCWFAFGFTFFGLALDLQALGSNIFLLQMFIGVVDIPAKMGALLLLSHLGRRPTLAASLLLAGLCI    351 - 420
LANTLVPHEMGALRSALAVLGLGGVGAAFTCITIYSSELFPTVLRMTAVGLGQMAARGGAILGPLVRLLG    421 - 490
VHGPWLPLLVYGTVPVLSGLAALLLPETQSLPLPDTIQDVQNQAVKKATHGTLGNSVLKSTQF           491 - 553
//

Text Mined References (84)

PMID Year Title