Property Summary

NCBI Gene PubMed Count 10
PubMed Score 5.59
PubTator Score 3.12

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96S21 A2IDE2 D3DU54 O60795 Q4TT41 Q5PXE8 Q6PIU5
Symbols RARL
RASL8C

Gene

Gene RIF (1)

PMID Text
23638186 Rab40c is a novel Rab protein associated with lipid droplets, and is likely involved in modulating the biogenesis of lipid droplets.

AA Sequence

MGSQGSPVKSYDYLLKFLLVGDSDVGKGEILESLQDGAAESPYAYSNGIDYKTTTILLDGRRVKLELWDT      1 - 70
SGQGRFCTIFRSYSRGAQGILLVYDITNRWSFDGIDRWIKEIDEHAPGVPRILVGNRLHLAFKRQVPTEQ     71 - 140
ARAYAEKNCMTFFEVSPLCNFNVIESFTELSRIVLMRHGMEKIWRPNRVFSLQDLCCRAIVSCTPVHLID    141 - 210
KLPLPVTIKSHLKSFSMANGMNAVMMHGRSYSLASGAGGGGSKGNSLKRSKSIRPPQSPPQNCSRSNCKI    211 - 280
S//

Text Mined References (12)

PMID Year Title
23638186 2013 Small GTPase Rab40c associates with lipid droplets and modulates the biogenesis of lipid droplets.
22993228 2013 Novel genetic variants associated with lumbar disc degeneration in northern Europeans: a meta-analysis of 4600 subjects.
18485483 2008 Rab GTPases and their roles in brain neurons and glia.
18391950 2008 Identification of ten loci associated with height highlights new biological pathways in human growth.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15601820 2004 VHL-box and SOCS-box domains determine binding specificity for Cul2-Rbx1 and Cul5-Rbx2 modules of ubiquitin ligases.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12076535 2002 The SOCS box: a tale of destruction and degradation.
11697911 2001 Evolution of the Rab family of small GTP-binding proteins.
More...