Property Summary

NCBI Gene PubMed Count 5
PubMed Score 0.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
Breast cancer 3578 6.1e-11
tuberculosis 2010 3.0e-09
ovarian cancer 8520 1.3e-04
osteosarcoma 7950 1.6e-03

Expression

  Differential Expression (4)

Disease log2 FC p
Breast cancer 1.100 6.1e-11
osteosarcoma 1.064 1.6e-03
ovarian cancer 1.100 1.3e-04
tuberculosis 1.400 3.0e-09

 Compartment GO Term (1)

AA Sequence

MLVAAAAERNKDPILHVLRQYLDPAQRGVRVLEVASGSGQHAAHFARAFPLAEWQPSDVDQRCLDSIAAT      1 - 70
TQAQGLTNVKAPLHLDVTWGWEHWGGILPQSLDLLLCINMAHVSPLRCTEGLFRAAGHLLKPRALLITYG     71 - 140
PYAINGKISPQSNVDFDLMLRCRNPEWGLRDTALLEDLGKASGLLLERMVDMPANNKCLIFRKN          141 - 204
//

Text Mined References (9)

PMID Year Title