Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.62

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (1)

Disease Z-score Confidence
non primary Sjogren syndrome sicca 840

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.400 0.024

AA Sequence

MVTGGAHSRSRGGLPSASRRGLFRGGPKEVTSGVRPGSRPLPRRRSCRPMAGGWAQGSRRAARLPEGGRL      1 - 70
MAPASRLLALWALAAVALPGSGAEGDGGWRPGGPGAVAEEERCTVERRADLTYAEFVQQYAFVRPVILQG     71 - 140
LTDNSRFRALCSRDRLLASFGDRVVRLSTANTYSYHKVDLPFQEYVEQLLHPQDPTSLGNDTLYFFGDNN    141 - 210
FTEWASLFRHYSPPPFGLLGTAPAYSFGIAGAGSGVPFHWHGPGYSEVIYGRKRWFLYPPEKTPEFHPNK    211 - 280
TTLAWLRDTYPALPPSARPLECTIRAGEVLYFPDRWWHATLNLDTSVFISTFLG                    281 - 334
//

Publication (9)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
16751776 2006 A germline-specific class of small RNAs binds mammalian Piwi proteins.
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
15498874 2004 Large-scale cDNA transfection screening for genes related to cancer development and progression.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15146197 2004 Transcriptome characterization elucidates signaling networks that control human ES cell growth and differentiation.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12107413 2002 Expressed sequence tag analysis of adult human lens for the NEIBank Project: over 2000 non-redundant transcripts, novel genes and splice variants.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.