Property Summary

NCBI Gene PubMed Count 7
PubMed Score 2.60

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
non primary Sjogren syndrome sicca 891 2.4e-02

Expression

  Differential Expression (1)

Disease log2 FC p
non primary Sjogren syndrome sicca 1.400 2.4e-02

Synonym

Accession Q96S16 B2RNS7 D3DU58 Q4PKE3 Q4VBY1 Q6GMW5 Q71RB8
Symbols PP14397
C16orf20

Gene

PANTHER Protein Class (1)

  Ortholog (1)

Species Source Disease
Macaque OMA EggNOG Inparanoid

 GO Component (1)

 Compartment GO Term (0)

Gene RIF (1)

AA Sequence

MVTGGAHSRSRGGLPSASRRGLFRGGPKEVTSGVRPGSRPLPRRRSCRPMAGGWAQGSRRAARLPEGGRL      1 - 70
MAPASRLLALWALAAVALPGSGAEGDGGWRPGGPGAVAEEERCTVERRADLTYAEFVQQYAFVRPVILQG     71 - 140
LTDNSRFRALCSRDRLLASFGDRVVRLSTANTYSYHKVDLPFQEYVEQLLHPQDPTSLGNDTLYFFGDNN    141 - 210
FTEWASLFRHYSPPPFGLLGTAPAYSFGIAGAGSGVPFHWHGPGYSEVIYGRKRWFLYPPEKTPEFHPNK    211 - 280
TTLAWLRDTYPALPPSARPLECTIRAGEVLYFPDRWWHATLNLDTSVFISTFLG                    281 - 334
//

Text Mined References (10)

PMID Year Title