Property Summary

NCBI Gene PubMed Count 12
PubMed Score 1.02
PubTator Score 0.55

Knowledge Summary

Patent

No data available

Expression

AA Sequence

MGKKRTTSGEGRERQRLPARRFRTTSPAALRADSVDGGSLLAPLLGLTDRAFSDCPDLADGAMEKMSRVT      1 - 70
TALGGSVLTGRTMHCHLDAPANAISVCRDAAQVVVAGRSIFKIYAIEEEQFVEKLNLRVGRKPSLNLSCA     71 - 140
DVVWHQMDENLLATAATNGVVVTWNLGRPSRNKQDQLFTEHKRTVNKVCFHPTEAHVLLSGSQDGFMKCF    141 - 210
DLRRKDSVSTFSGEATEAGPREWAMAGCVPILPVLSCRILRLHHSFAHGPMQDAESTANDARESWGCPLY    211 - 280
PLGLCSGPQAGQSESVRDVQFSIRDYFTFASTFENGNVQLWDIRRPDRCERMFTAHNGPVFCCDWHPEDR    281 - 350
GWLATGGRDKMVKVWDMTTHRAKEMHCVQTIASVARVKWRPECRHHLATCSMMVDHNIYVWDVRRPFVPA    351 - 420
AMFEEHRDVTTGIAWRHPHDPSFLLSGSKDSSLCQHLFRDASQPVERANPEGLCYGLFGDLAFAAKESLV    421 - 490
AAESGRKPYTGDRRHPIFFKRKLDPAEPFAGLASSALSVFETEPGGGGMRWFVDTAERYALAGRPLAELC    491 - 560
DHNAKVARELGRNQVAQTWTMLRIIYCSPGLVPTANLNHSVGKGGSCGLPLMNSFNLKDMAPGLGSETRL    561 - 630
DRSKGDARSDTVLLDSSATLITNEDNEETEGSDVPADYLLGDVEGEEDELYLLDPEHAHPEDPECVLPQE    631 - 700
AFPLRHEIVDTPPGPEHLQDKADSPHVSGSEADVASLAPVDSSFSLLSVSHALYDSRLPPDFFGVLVRDM    701 - 770
LHFYAEQGDVQMAVSVLIVLGERVRKDIDEQTQEHWYTSYIDLLQRFRLWNVSNEVVKLSTSRAVSCLNQ    771 - 840
ASTTLHVNCSHCKRPMSSRGWVCDRCHRCASMCAVCHHVVKGLFVWCQGCSHGGHLQHIMKWLEGSSHCP    841 - 910
AGCGHLCEYS                                                                911 - 920
//

Publication (21)

PMID Year Title
27487210 2016 Mechanism of arginine sensing by CASTOR1 upstream of mTORC1.
27166823 2016 The GATOR2 Component Wdr24 Regulates TORC1 Activity and Lysosome Function.
26972053 2016 The CASTOR Proteins Are Arginine Sensors for the mTORC1 Pathway.
26586190 2016 Structural basis for leucine sensing by the Sestrin2-mTORC1 pathway.
26449471 2016 Sestrin2 is a leucine sensor for the mTORC1 pathway.
25457612 2014 Sestrins inhibit mTORC1 kinase activation through the GATOR complex.
25416956 2014 A proteome-scale map of the human interactome network.
25263562 2014 The Sestrins interact with GATOR2 to negatively regulate the amino-acid-sensing pathway upstream of mTORC1.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23723238 2013 A Tumor suppressor complex with GAP activity for the Rag GTPases that signal amino acid sufficiency to mTORC1.
More...