Property Summary

NCBI Gene PubMed Count 1
PubMed Score 1.33

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q96S07
Symbols gs64

Gene

 Compartment GO Term (1)

AA Sequence

MARTDQKPPCRGGCWGQPGHPNTGGAAAHPTYHPMGHRPRTCILLRGDQTTGGQAPSREISLGPWAAGTH      1 - 70
FLAISTTPWGRKTPACISELPTSSGTAQPLANAVCEVQTVPGPGLRPQGTPAMRAPSHKGTPPTPNPWGP     71 - 140
EQPQNRHKHPKKGVTGGPSPPPPAASRYGQTPGREPRVQAPGLGPCGRPASGRLLSLHLEKGDGKGTRQR    141 - 210
IPLTDAAVGGDRTDIPSAIAAGPARTPDRHGLPIPGSTPTPMVGSGRLGAPVGRSGGGASARSSRPSCAN    211 - 280
VLLRADASLGTVLSVLWTGQLSRGWALLPPGDAGRHLETSVISAGVAAGIWLVEPGEAAQDPATRRTAPP    281 - 350
RRTASPEPPAPGAPLPACPGRIPGAARFGPRSCPLGSPAVLAVTTGWSHRSV                      351 - 402
//

Publication (2)

PMID Year Title
15616553 2004 The sequence and analysis of duplication-rich human chromosome 16.
11157797 2001 Sequence, structure and pathology of the fully annotated terminal 2 Mb of the short arm of human chromosome 16.