Property Summary

NCBI Gene PubMed Count 18
PubMed Score 24.54
PubTator Score 10.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
glioblastoma -1.100 1.4e-02
group 4 medulloblastoma -1.100 5.7e-04
intraductal papillary-mucinous neoplasm ... 1.200 1.6e-03
lung cancer -1.300 1.4e-02
medulloblastoma, large-cell -2.200 3.3e-06
osteosarcoma 1.087 4.4e-06
ovarian cancer -1.400 2.6e-08
pituitary cancer 1.100 3.9e-05
tuberculosis 1.200 8.9e-06

Gene RIF (8)

AA Sequence

MRPDSPTMAAPAESLRRRKTGYSDPEPESPPAPGRGPAGSPAHLHTGTFWLTRIVLLKALAFVYFVAFLV      1 - 70
AFHQNKQLIGDRGLLPCRVFLKNFQQYFQDRTSWEVFSYMPTILWLMDWSDMNSNLDLLALLGLGISSFV     71 - 140
LITGCANMLLMAALWGLYMSLVNVGHVWYSFGWESQLLETGFLGIFLCPLWTLSRLPQHTPTSRIVLWGF    141 - 210
RWLIFRIMLGAGLIKIRGDRCWRDLTCMDFHYETQPMPNPVAYYLHHSPWWFHRFETLSNHFIELLVPFF    211 - 280
LFLGRRACIIHGVLQILFQAVLIVSGNLSFLNWLTMVPSLACFDDATLGFLFPSGPGSLKDRVLQMQRDI    281 - 350
RGARPEPRFGSVVRRAANVSLGVLLAWLSVPVVLNLLSSRQVMNTHFNSLHIVNTYGAFGSITKERAEVI    351 - 420
LQGTASSNASAPDAMWEDYEFKCKPGDPSRRPCLISPYHYRLDWLMWFAAFQTYEHNDWIIHLAGKLLAS    421 - 490
DAEALSLLAHNPFAGRPPPRWVRGEHYRYKFSRPGGRHAAEGKWWVRKRIGAYFPPLSLEELRPYFRDRG    491 - 560
WPLPGPL                                                                   561 - 567
//

Text Mined References (19)

PMID Year Title