Property Summary

NCBI Gene PubMed Count 81
PubMed Score 59.43
PubTator Score 57.82

Knowledge Summary

Patent (4,560)

Expression

  Differential Expression (24)

Disease log2 FC p
adrenocortical adenoma -1.090 1.9e-02
adrenocortical carcinoma -1.320 1.2e-02
aldosterone-producing adenoma -2.112 1.1e-02
astrocytoma 1.600 2.4e-02
Barrett's esophagus 1.400 1.1e-02
Chronic Lymphocytic Leukemia 1.347 1.1e-02
chronic rhinosinusitis -1.386 3.9e-02
dermatomyositis 1.200 1.5e-03
esophageal adenocarcinoma 1.300 2.0e-02
glioblastoma 1.400 7.0e-03
inflammatory breast cancer -1.200 1.1e-02
interstitial cystitis 1.400 2.7e-03
interstitial lung disease -1.200 4.7e-02
lung cancer -2.900 6.4e-06
medulloblastoma, large-cell 1.200 1.9e-02
mucosa-associated lymphoid tissue lympho... 1.772 5.5e-03
nephrosclerosis -1.044 9.3e-04
non diabetic and post-ischemic heart fai... -1.400 9.5e-03
non-small cell lung cancer -1.102 1.9e-09
osteosarcoma -1.701 2.1e-02
ovarian cancer 3.100 2.4e-05
Rheumatoid arthritis 1.400 2.8e-03
ulcerative colitis 1.100 2.4e-04
Waldenstrons macroglobulinemia 2.003 4.3e-02

Synonym

Accession Q96RU8 B4DMM6 C5HU08 O15180 Q9H2Y8 TRB-1
Symbols C8FW
GIG2
TRB1
GIG-2
SKIP1
TRB-1

Gene

PANTHER Protein Class (3)

PDB

5CEK   5CEM   5IGO   5IGQ  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

 GO Component (2)

Protein-protein Interaction (6)

Gene RIF (58)

AA Sequence

MRVGPVRSAMSGASQPRGPALLFPATRGVPAKRLLDADDAAAVAAKCPRLSECSSPPDYLSPPGSPCSPQ      1 - 70
PPPAAPGAGGGSGSAPGPSRIADYLLLPLAEREHVSRALCIHTGRELRCKVFPIKHYQDKIRPYIQLPSH     71 - 140
SNITGIVEVILGETKAYVFFEKDFGDMHSYVRSRKRLREEEAARLFKQIVSAVAHCHQSAIVLGDLKLRK    141 - 210
FVFSTEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKAADVWSLGVMLYTLLVG    211 - 280
RYPFHDSDPSALFSKIRRGQFCIPEHISPKARCLIRSLLRREPSERLTAPEILLHPWFESVLEPGYIDSE    281 - 350
IGTSDQIVPEYQEDSDISSFFC                                                    351 - 372
//

Text Mined References (86)

PMID Year Title