Property Summary

NCBI Gene PubMed Count 78
PubMed Score 64.06
PubTator Score 57.82

Knowledge Summary

Patent (4,560)

TINX Plot

  Disease Sources (2)

Disease Target Count
Coronary artery disease 240
Disease Target Count P-value
non-small cell lung cancer 2798 1.87430874995854E-9
lung cancer 4473 5.6459720908464E-7
ovarian cancer 8492 2.39502039406189E-5
interstitial cystitis 2299 8.24220231252311E-5
nephrosclerosis 329 9.25613700503229E-4
dermatomyositis 967 0.00146683685317815
Rheumatoid Arthritis 1171 0.00275339965519361
mucosa-associated lymphoid tissue lymphoma 480 0.00548443525379947
glioblastoma 5572 0.00696698802935142
ulcerative colitis 2087 0.00847636894744942
non diabetic and post-ischemic heart failure 200 0.00952753830966362
Barrett's esophagus 185 0.0110746017619289
inflammatory breast cancer 404 0.0111395008822094
chronic lymphocytic leukemia 244 0.0112199491713193
aldosterone-producing adenoma 664 0.0113483878095538
adrenocortical carcinoma 1427 0.0121050125210228
medulloblastoma, large-cell 6234 0.0186277572377359
adrenocortical adenoma 134 0.0190940811951218
esophageal adenocarcinoma 737 0.0195207517873976
osteosarcoma 7933 0.0210913077709663
astrocytoma 1493 0.0237532128358703
chronic rhinosinusitis 512 0.0394818265401774
Waldenstrons macroglobulinemia 765 0.0431865980765297
interstitial lung disease 292 0.0472615785644859

Expression

Synonym

Accession Q96RU8 B4DMM6 C5HU08 O15180 Q9H2Y8 TRB-1
Symbols C8FW
GIG2
TRB1
GIG-2
SKIP1
TRB-1

Gene

PANTHER Protein Class (3)

PDB

5CEK   5CEM   5IGO   5IGQ  

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid

 GO Component (2)

Pathway (1)

Gene RIF (55)

PMID Text
26521947 Trib1 formed a complex with pHDAC1.
26517934 Studies show a remarkable reduction in tribbles 2 protein (Trib2) expression during oocyte maturation whereas tribbles 1 protein (Trib1) and tribbles 3 protein (Trib3) expression was significantly increased during this process.
26517933 Studies show that TRIB1 and TRIB2 are highly expressed in molecularly-defined sub-types of acute myeloid leukemia (AML).
26517931 Studies indicate that overexpression of the wild-type tribbles homolog 1 (Drosophila) protein (Trib1) gene effectively induces leukaemia.
26517930 Studies indicate that small molecules can reveal rate-limiting signalling outputs and functions of pseudo-kinase family of tribbles (TRIB) proteins TRIB1, TRIB2 and TRIB3 in cells and intact organisms, serving as guides for the development of new drugs.
26517927 Studies indicate that tribbles homolog 1 (Drosophila) protein (tribbles-1; TRIB1) is an important modulator of human energy metabolism and metabolic syndromes.
26517926 Studies indicate that tribbles homolog 1 (Drosophila) protein (TRIB1) interacts with the master molecule of Tregs, forkhead box P3 (FOXP3), a transcription factor essential for Treg suppressive activity.
26517925 Studies suggest that pseudo-kinase family of tribbles (TRIB) proteins TRIB1, TRIB2 and TRIB3 were involved in the pathogenesis of inflammation.
26517924 Studies indicate that the minor allele of a single nucleotide polymorphism (SNP, rs6982502) in the regulatory sequence reduces the activity of the tribbles homolog 1 (Drosophila) protein (TRIB1) promoter.
26517922 Studies suggest that pseudo-kinase family of tribbles (TRIB) proteins TRIB1, TRIB2 and TRIB3 play roles in pathogenesis of rheumatoid arthritis (RA) and osteoarthritis.
More...

AA Sequence

MRVGPVRSAMSGASQPRGPALLFPATRGVPAKRLLDADDAAAVAAKCPRLSECSSPPDYLSPPGSPCSPQ      1 - 70
PPPAAPGAGGGSGSAPGPSRIADYLLLPLAEREHVSRALCIHTGRELRCKVFPIKHYQDKIRPYIQLPSH     71 - 140
SNITGIVEVILGETKAYVFFEKDFGDMHSYVRSRKRLREEEAARLFKQIVSAVAHCHQSAIVLGDLKLRK    141 - 210
FVFSTEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKAADVWSLGVMLYTLLVG    211 - 280
RYPFHDSDPSALFSKIRRGQFCIPEHISPKARCLIRSLLRREPSERLTAPEILLHPWFESVLEPGYIDSE    281 - 350
IGTSDQIVPEYQEDSDISSFFC                                                    351 - 372
//

Text Mined References (81)

PMID Year Title
26521947 2015 Inhibition of tribbles protein-1 attenuates radioresistance in human glioma cells.
26517934 2015 Tribbles role in reproduction.
26517933 2015 Tribbles in normal and malignant haematopoiesis.
26517931 2015 The role of Trib1 in myeloid leukaemogenesis and differentiation.
26517930 2015 Tribbles pseudokinases: novel targets for chemical biology and drug discovery?
26517927 2015 Tribbles-1: a novel regulator of hepatic lipid metabolism in humans.
26517926 2015 Deciphering the role of TRIB1 in regulatory T-cells.
26517925 2015 Tribbles in inflammation.
26517924 2015 The role of TRIB1 in lipid metabolism; from genetics to pathways.
26517922 2015 Tribbles and arthritis: what are the links?
More...