Property Summary

NCBI Gene PubMed Count 78
Grant Count 20
R01 Count 14
Funding $1,019,143.97
PubMed Score 64.06
PubTator Score 57.82

Knowledge Summary

Patent (4,560)

Expression

 GO Component (2)

Gene RIF (55)

PMID Text
26521947 Trib1 formed a complex with pHDAC1.
26517934 Studies show a remarkable reduction in tribbles 2 protein (Trib2) expression during oocyte maturation whereas tribbles 1 protein (Trib1) and tribbles 3 protein (Trib3) expression was significantly increased during this process.
26517933 Studies show that TRIB1 and TRIB2 are highly expressed in molecularly-defined sub-types of acute myeloid leukemia (AML).
26517931 Studies indicate that overexpression of the wild-type tribbles homolog 1 (Drosophila) protein (Trib1) gene effectively induces leukaemia.
26517930 Studies indicate that small molecules can reveal rate-limiting signalling outputs and functions of pseudo-kinase family of tribbles (TRIB) proteins TRIB1, TRIB2 and TRIB3 in cells and intact organisms, serving as guides for the development of new drugs.
26517927 Studies indicate that tribbles homolog 1 (Drosophila) protein (tribbles-1; TRIB1) is an important modulator of human energy metabolism and metabolic syndromes.
26517926 Studies indicate that tribbles homolog 1 (Drosophila) protein (TRIB1) interacts with the master molecule of Tregs, forkhead box P3 (FOXP3), a transcription factor essential for Treg suppressive activity.
26517925 Studies suggest that pseudo-kinase family of tribbles (TRIB) proteins TRIB1, TRIB2 and TRIB3 were involved in the pathogenesis of inflammation.
26517924 Studies indicate that the minor allele of a single nucleotide polymorphism (SNP, rs6982502) in the regulatory sequence reduces the activity of the tribbles homolog 1 (Drosophila) protein (TRIB1) promoter.
26517922 Studies suggest that pseudo-kinase family of tribbles (TRIB) proteins TRIB1, TRIB2 and TRIB3 play roles in pathogenesis of rheumatoid arthritis (RA) and osteoarthritis.
More...

AA Sequence

MRVGPVRSAMSGASQPRGPALLFPATRGVPAKRLLDADDAAAVAAKCPRLSECSSPPDYLSPPGSPCSPQ      1 - 70
PPPAAPGAGGGSGSAPGPSRIADYLLLPLAEREHVSRALCIHTGRELRCKVFPIKHYQDKIRPYIQLPSH     71 - 140
SNITGIVEVILGETKAYVFFEKDFGDMHSYVRSRKRLREEEAARLFKQIVSAVAHCHQSAIVLGDLKLRK    141 - 210
FVFSTEERTQLRLESLEDTHIMKGEDDALSDKHGCPAYVSPEILNTTGTYSGKAADVWSLGVMLYTLLVG    211 - 280
RYPFHDSDPSALFSKIRRGQFCIPEHISPKARCLIRSLLRREPSERLTAPEILLHPWFESVLEPGYIDSE    281 - 350
IGTSDQIVPEYQEDSDISSFFC                                                    351 - 372
//

Text Mined References (81)

PMID Year Title
26521947 2015 Inhibition of tribbles protein-1 attenuates radioresistance in human glioma cells.
26517934 2015 Tribbles role in reproduction.
26517933 2015 Tribbles in normal and malignant haematopoiesis.
26517931 2015 The role of Trib1 in myeloid leukaemogenesis and differentiation.
26517930 2015 Tribbles pseudokinases: novel targets for chemical biology and drug discovery?
26517927 2015 Tribbles-1: a novel regulator of hepatic lipid metabolism in humans.
26517926 2015 Deciphering the role of TRIB1 in regulatory T-cells.
26517925 2015 Tribbles in inflammation.
26517924 2015 The role of TRIB1 in lipid metabolism; from genetics to pathways.
26517922 2015 Tribbles and arthritis: what are the links?
More...