Property Summary

NCBI Gene PubMed Count 85
Grant Count 25
R01 Count 18
Funding $1,504,938.56
PubMed Score 82.79
PubTator Score 151.08

Knowledge Summary

Patent (7,609)

Expression

  Differential Expression (14)

Disease log2 FC p
malignant mesothelioma 2.500 0.000
psoriasis 2.300 0.000
osteosarcoma 1.392 0.003
adrenocortical carcinoma 1.165 0.008
non-small cell lung cancer 1.146 0.000
X-linked cerebral adrenoleukodystrophy 2.100 0.036
breast carcinoma 1.100 0.006
fibroadenoma 1.200 0.004
cystic fibrosis 1.100 0.001
non primary Sjogren syndrome sicca 1.100 0.019
Polycystic Ovary Syndrome -1.391 0.017
ductal carcinoma in situ 1.900 0.001
invasive ductal carcinoma 2.300 0.002
pituitary cancer -2.000 0.000

Gene RIF (74)

PMID Text
26584255 TRB3 is upregulated in macrophages upon treatment with ox-LDL. TRB3 promotes lipid accumulation and suppresses cytokine expression, suggesting inflammation and foam cell formation can be reciprocally regulated.
26517935 Studies show that tribbles pseudokinase 3 (TRIB3) plays a crucial role in the anti-cancer activity of cannabinoids and that TRIB3 genetic inactivation enhances cancer generation and progression.
26517934 Studies show a remarkable reduction in tribbles 2 protein (Trib2) expression during oocyte maturation whereas tribbles 1 protein (Trib1) and tribbles 3 protein (Trib3) expression was significantly increased during this process.
26517932 Studies suggest that the tribbles homolog 3 (Drosophila) protein (TRIB3) Q84R missense polymorphis contributes to atherosclerosis.
26517930 Studies indicate that small molecules can reveal rate-limiting signalling outputs and functions of pseudo-kinase family of tribbles (TRIB) proteins TRIB1, TRIB2 and TRIB3 in cells and intact organisms, serving as guides for the development of new drugs.
26517925 Studies suggest that pseudo-kinase family of tribbles (TRIB) proteins TRIB1, TRIB2 and TRIB3 were involved in the pathogenesis of inflammation.
26517922 Studies suggest that pseudo-kinase family of tribbles (TRIB) proteins TRIB1, TRIB2 and TRIB3 play roles in pathogenesis of rheumatoid arthritis (RA) and osteoarthritis.
26253791 Suggest a role of TRIB3 low-frequency variants on coronary artery disease risk among Italian patients with T2D.
26224857 Trib3 interferes with the Parkinson's disease-associated prosurvival protein Parkin to mediate death
26094770 These results implicate TRIB3 and IGFBP2, both of which are known to be overexpressed in several types of cancers, as pro-survival modulators of cell viability in nutrient-deficient microenvironments.
More...

AA Sequence

MRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAVATASRLGP      1 - 70
YVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHVARPTEVLAGTQLLYAFFTRT     71 - 140
HGDMHSLVRSRHRIPEPEAAVLFRQMATALAHCHQHGLVLRDLKLCRFVFADRERKKLVLENLEDSCVLT    141 - 210
GPDDSLWDKHACPAYVGPEILSSRASYSGKAADVWSLGVALFTMLAGHYPFQDSEPVLLFGKIRRGAYAL    211 - 280
PAGLSAPARCLVRCLLRREPAERLTATGILLHPWLRQDPMPLAPTRSHLWEAAQVVPDGLGLDEAREEEG    281 - 350
DREVVLYG                                                                  351 - 358
//

Text Mined References (87)

PMID Year Title
26584255 2016 Tribbles Homolog 3 Promotes Foam Cell Formation Associated with Decreased Proinflammatory Cytokine Production in Macrophages: Evidence for Reciprocal Regulation of Cholesterol Uptake and Inflammation.
26517935 2015 Oncosuppressive functions of tribbles pseudokinase 3.
26517934 2015 Tribbles role in reproduction.
26517932 2015 The TRIB3 Q84R polymorphism, insulin resistance and related metabolic alterations.
26517930 2015 Tribbles pseudokinases: novel targets for chemical biology and drug discovery?
26517925 2015 Tribbles in inflammation.
26517922 2015 Tribbles and arthritis: what are the links?
26253791 2015 Infrequent TRIB3 coding variants and coronary artery disease in type 2 diabetes.
26224857 2015 Trib3 Is Elevated in Parkinson's Disease and Mediates Death in Parkinson's Disease Models.
26094770 2015 TRIB3 enhances cell viability during glucose deprivation in HEK293-derived cells by upregulating IGFBP2, a novel nutrient deficiency survival factor.
More...