Property Summary

NCBI Gene PubMed Count 96
PubMed Score 97.67
PubTator Score 151.08

Knowledge Summary

Patent (7,609)

Expression

  Differential Expression (14)

Disease log2 FC p
adrenocortical carcinoma 1.165 7.9e-03
breast carcinoma 1.100 5.8e-03
cystic fibrosis 1.100 1.3e-03
ductal carcinoma in situ 1.900 7.5e-04
fibroadenoma 1.200 3.7e-03
invasive ductal carcinoma 2.300 1.9e-03
malignant mesothelioma 2.500 7.1e-08
non primary Sjogren syndrome sicca 1.100 1.9e-02
non-small cell lung cancer 1.146 3.3e-12
osteosarcoma 1.354 8.0e-06
pituitary cancer -2.000 1.8e-05
Polycystic ovary syndrome -1.391 1.7e-02
psoriasis 2.300 2.2e-04
X-linked cerebral adrenoleukodystrophy 1.400 4.9e-02

Protein-protein Interaction (3)

Gene RIF (83)

AA Sequence

MRATPLAAPAGSLSRKKRLELDDNLDTERPVQKRARSGPQPRLPPCLLPLSPPTAPDRATAVATASRLGP      1 - 70
YVLLEPEEGGRAYQALHCPTGTEYTCKVYPVQEALAVLEPYARLPPHKHVARPTEVLAGTQLLYAFFTRT     71 - 140
HGDMHSLVRSRHRIPEPEAAVLFRQMATALAHCHQHGLVLRDLKLCRFVFADRERKKLVLENLEDSCVLT    141 - 210
GPDDSLWDKHACPAYVGPEILSSRASYSGKAADVWSLGVALFTMLAGHYPFQDSEPVLLFGKIRRGAYAL    211 - 280
PAGLSAPARCLVRCLLRREPAERLTATGILLHPWLRQDPMPLAPTRSHLWEAAQVVPDGLGLDEAREEEG    281 - 350
DREVVLYG                                                                  351 - 358
//

Text Mined References (98)

PMID Year Title