Property Summary

NCBI Gene PubMed Count 31
Grant Count 6
R01 Count 3
Funding $601,173.83
PubMed Score 13.33
PubTator Score 16.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Gene RIF (13)

PMID Text
25938814 FBP17 is the local activator of actin polymerization that is inhibited by PM tension in the feedback loop that regulates cell migration.
23525018 Knockdown of PSTPIP2 inmacrophages enhances the assembly of FBP17, leading to'hyperactivation' of actin nucleation at podosomes and ECM degradation.
21768103 F-BAR protein Rapostlin, whose activity is regulated by Rnd2, plays a key role in spine formation through the regulation of membrane dynamics.
20729836 Results suggest a functional link between FBP17-dependent membrane tubulation and clathrin-dependent budding. Clathrin spatially directs membrane invaginations that lead to the generation of endocytic vesicles larger than those enclosed by the coat.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19155218 formin-binding protein 17 (FBP17) recruits WASP, WASP-interacting protein (WIP), and dynamin-2 to the plasma membrane and that this recruitment is necessary for the formation of podosomes and phagocytic cups.
18923421 N-WASP-WIP complex-mediated actin polymerization is activated by phosphatidylserine-containing membranes depending on membrane curvature in the presence of Toca-1 or FBP17 and in the absence of Cdc42 and phosphatidylinositol (4,5)-bisphosphate.
17512409 FBP17 is recruited to clathrin-coated pits in the late stage of endocytosis, indicating its physiological role.
16418535 Data indicate that PCH protein family members such as FBP17 couple membrane deformation to actin cytoskeleton reorganization in various cellular processes.
15252009 FBP17 interacts with dynamin and regulates endocytosis by forming vesicotubular structures
More...

AA Sequence

MSWGTELWDQFDNLEKHTQWGIDILEKYIKFVKERTEIELSYAKQLRNLSKKYQPKKNSKEEEEYKYTSC      1 - 70
KAFISNLNEMNDYAGQHEVISENMASQIIVDLARYVQELKQERKSNFHDGRKAQQHIETCWKQLESSKRR     71 - 140
FERDCKEADRAQQYFEKMDADINVTKADVEKARQQAQIRHQMAEDSKADYSSILQKFNHEQHEYYHTHIP    141 - 210
NIFQKIQEMEERRIVRMGESMKTYAEVDRQVIPIIGKCLDGIVKAAESIDQKNDSQLVIEAYKSGFEPPG    211 - 280
DIEFEDYTQPMKRTVSDNSLSNSRGEGKPDLKFGGKSKGKLWPFIKKNKLMSLLTSPHQPPPPPPASASP    281 - 350
SAVPNGPQSPKQQKEPLSHRFNEFMTSKPKIHCFRSLKRGLSLKLGATPEDFSNLPPEQRRKKLQQKVDE    351 - 420
LNKEIQKEMDQRDAITKMKDVYLKNPQMGDPASLDHKLAEVSQNIEKLRVETQKFEAWLAEVEGRLPARS    421 - 490
EQARRQSGLYDSQNPPTVNNCAQDRESPDGSYTEEQSQESEMKVLATDFDDEFDDEEPLPAIGTCKALYT    491 - 560
FEGQNEGTISVVEGETLYVIEEDKGDGWTRIRRNEDEEGYVPTSYVEVCLDKNAKDS                 561 - 617
//

Text Mined References (41)

PMID Year Title
25938814 2015 Feedback regulation between plasma membrane tension and membrane-bending proteins organizes cell polarity during leading edge formation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23525018 2013 Antagonistic regulation of F-BAR protein assemblies controls actin polymerization during podosome formation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21768103 2011 The F-BAR protein Rapostlin regulates dendritic spine formation in hippocampal neurons.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20729836 2010 Coupling between clathrin-dependent endocytic budding and F-BAR-dependent tubulation in a cell-free system.
20562859 2010 Network organization of the human autophagy system.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...