Property Summary

NCBI Gene PubMed Count 32
PubMed Score 15.25
PubTator Score 16.34

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Disease log2 FC p
active ulcerative colitis -1.030 1.0e-02
adult high grade glioma -1.400 7.6e-03
astrocytic glioma 1.500 2.9e-02
Astrocytoma, Pilocytic -1.200 3.1e-04
atypical teratoid / rhabdoid tumor -1.300 7.3e-03
colon cancer -2.200 1.3e-05
cystic fibrosis -1.082 2.7e-05
dermatomyositis 1.200 1.9e-04
ependymoma -1.300 3.4e-04
glioblastoma -1.200 2.9e-03
interstitial cystitis 1.100 3.7e-03
interstitial lung disease 1.200 3.0e-02
intraductal papillary-mucinous adenoma (... 1.800 1.5e-03
invasive ductal carcinoma 1.131 2.6e-02
juvenile dermatomyositis 1.151 3.7e-12
medulloblastoma, large-cell -1.500 2.1e-02
oligodendroglioma 1.800 1.4e-03
osteosarcoma -2.548 4.4e-04
ovarian cancer -1.600 1.5e-04
primary Sjogren syndrome 1.300 3.5e-02
subependymal giant cell astrocytoma -1.724 3.3e-02
tuberculosis -1.100 4.3e-05
Waldenstrons macroglobulinemia 1.229 6.8e-03

Gene RIF (13)

AA Sequence

MSWGTELWDQFDNLEKHTQWGIDILEKYIKFVKERTEIELSYAKQLRNLSKKYQPKKNSKEEEEYKYTSC      1 - 70
KAFISNLNEMNDYAGQHEVISENMASQIIVDLARYVQELKQERKSNFHDGRKAQQHIETCWKQLESSKRR     71 - 140
FERDCKEADRAQQYFEKMDADINVTKADVEKARQQAQIRHQMAEDSKADYSSILQKFNHEQHEYYHTHIP    141 - 210
NIFQKIQEMEERRIVRMGESMKTYAEVDRQVIPIIGKCLDGIVKAAESIDQKNDSQLVIEAYKSGFEPPG    211 - 280
DIEFEDYTQPMKRTVSDNSLSNSRGEGKPDLKFGGKSKGKLWPFIKKNKLMSLLTSPHQPPPPPPASASP    281 - 350
SAVPNGPQSPKQQKEPLSHRFNEFMTSKPKIHCFRSLKRGLSLKLGATPEDFSNLPPEQRRKKLQQKVDE    351 - 420
LNKEIQKEMDQRDAITKMKDVYLKNPQMGDPASLDHKLAEVSQNIEKLRVETQKFEAWLAEVEGRLPARS    421 - 490
EQARRQSGLYDSQNPPTVNNCAQDRESPDGSYTEEQSQESEMKVLATDFDDEFDDEEPLPAIGTCKALYT    491 - 560
FEGQNEGTISVVEGETLYVIEEDKGDGWTRIRRNEDEEGYVPTSYVEVCLDKNAKDS                 561 - 617
//

Text Mined References (42)

PMID Year Title