Property Summary

NCBI Gene PubMed Count 26
Grant Count 4
R01 Count 1
Funding $320,524.67
PubMed Score 22.90
PubTator Score 24.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
osteosarcoma 2.699 0.000
medulloblastoma, large-cell 1.100 0.002
non-small cell lung cancer 1.042 0.000
ovarian cancer 1.700 0.000

Gene RIF (15)

PMID Text
26268556 findings provide a first insight into understanding how the enzymatic activity of Usp28 is regulated by its non-catalytic UBR and endogenous ligands.
26209720 These results showed that USP28 is overexpressed in human glioblastomas and it contributes to glioma tumorigenicity.
25656529 Data indicte that deubiquitinating enzyme USP28 was targeted by microRNA miR-4295.
25437563 Dual regulation of Fbw7 activity by Usp28 is a safeguard mechanism for maintaining physiological levels of proto-oncogenic Fbw7 substrates, which is equivalently disrupted by loss or overexpression of Usp28.
25359778 USP28 has a chain preference activity for Lys(11), Lys(48), and Lys(63) diubiquitin linkages
24960159 identified Usp28 as a c-MYC target gene highly expressed in colorectal cancers, which indicates that USP28 and c-MYC form a positive feedback loop that maintains high c-MYC protein levels in tumors
24687851 USP28 is not a critical factor in double-strand break metabolism and is unlikely to be an attractive target for therapeutic intervention aimed at chemotherapy sensitization.
24347490 Usp28 expression was indentified as a independent predictors of survival (P = 0.001) and potentially valuable in prognostic evaluation of bladder cancer
24075993 Study reveals a critical mechanism underlying the epigenetic regulation by USP28.
23832602 USP28 gene expression is down regulated by oxidative stress through the mediation of reactive oxygen species
More...

AA Sequence

MTAELQQDDAAGAADGHGSSCQMLLNQLREITGIQDPSFLHEALKASNGDITQAVSLLTDERVKEPSQDT      1 - 70
VATEPSEVEGSAANKEVLAKVIDLTHDNKDDLQAAIALSLLESPKIQADGRDLNRMHEATSAETKRSKRK     71 - 140
RCEVWGENPNPNDWRRVDGWPVGLKNVGNTCWFSAVIQSLFQLPEFRRLVLSYSLPQNVLENCRSHTEKR    141 - 210
NIMFMQELQYLFALMMGSNRKFVDPSAALDLLKGAFRSSEEQQQDVSEFTHKLLDWLEDAFQLAVNVNSP    211 - 280
RNKSENPMVQLFYGTFLTEGVREGKPFCNNETFGQYPLQVNGYRNLDECLEGAMVEGDVELLPSDHSVKY    281 - 350
GQERWFTKLPPVLTFELSRFEFNQSLGQPEKIHNKLEFPQIIYMDRYMYRSKELIRNKRECIRKLKEEIK    351 - 420
ILQQKLERYVKYGSGPARFPLPDMLKYVIEFASTKPASESCPPESDTHMTLPLSSVHCSVSDQTSKESTS    421 - 490
TESSSQDVESTFSSPEDSLPKSKPLTSSRSSMEMPSQPAPRTVTDEEINFVKTCLQRWRSEIEQDIQDLK    491 - 560
TCIASTTQTIEQMYCDPLLRQVPYRLHAVLVHEGQANAGHYWAYIYNQPRQSWLKYNDISVTESSWEEVE    561 - 630
RDSYGGLRNVSAYCLMYINDKLPYFNAEAAPTESDQMSEVEALSVELKHYIQEDNWRFEQEVEEWEEEQS    631 - 700
CKIPQMESSTNSSSQDYSTSQEPSVASSHGVRCLSSEHAVIVKEQTAQAIANTARAYEKSGVEAALSEVM    701 - 770
LSPAMQGVILAIAKARQTFDRDGSEAGLIKAFHEEYSRLYQLAKETPTSHSDPRLQHVLVYFFQNEAPKR    771 - 840
VVERTLLEQFADKNLSYDERSISIMKVAQAKLKEIGPDDMNMEEYKKWHEDYSLFRKVSVYLLTGLELYQ    841 - 910
KGKYQEALSYLVYAYQSNAALLMKGPRRGVKESVIALYRRKCLLELNAKAASLFETNDDHSVTEGINVMN    911 - 980
ELIIPCIHLIINNDISKDDLDAIEVMRNHWCSYLGQDIAENLQLCLGEFLPRLLDPSAEIIVLKEPPTIR    981 - 1050
PNSPYDLCSRFAAVMESIQGVSTVTVK                                              1051 - 1077
//

Text Mined References (33)

PMID Year Title
27432897 2016 53BP1 and USP28 mediate p53 activation and G1 arrest after centrosome loss or extended mitotic duration.
27432896 2016 A USP28-53BP1-p53-p21 signaling axis arrests growth after centrosome loss or prolonged mitosis.
27371829 2016 53BP1 and USP28 mediate p53-dependent cell cycle arrest in response to centrosome loss and prolonged mitosis.
26268556 2015 The N-terminal ubiquitin-binding region of ubiquitin-specific protease 28 modulates its deubiquitination function: NMR structural and mechanistic insights.
26209720 2016 Ubiquitin-specific protease 28 is overexpressed in human glioblastomas and contributes to glioma tumorigenicity by regulating MYC expression.
25656529 2015 Overexpression of deubiquitinating enzyme USP28 promoted non-small cell lung cancer growth.
25437563 2014 Dual regulation of Fbw7 function and oncogenic transformation by Usp28.
25359778 2014 Regulation of USP28 deubiquitinating activity by SUMO conjugation.
24960159 2014 The deubiquitinase USP28 controls intestinal homeostasis and promotes colorectal cancer.
24687851 2014 USP28 is recruited to sites of DNA damage by the tandem BRCT domains of 53BP1 but plays a minor role in double-strand break metabolism.
More...