Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.88
PubTator Score 5.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
malignant mesothelioma 3232 1.3e-07
psoriasis 6694 3.3e-05
osteosarcoma 7950 9.0e-05
tuberculosis and treatment for 6 months 409 8.8e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Angelman syndrome 34 4.724 2.4
obsessive-compulsive disorder 61 3.008 1.5

Expression

  Differential Expression (4)

Disease log2 FC p
malignant mesothelioma -2.100 1.3e-07
osteosarcoma -1.386 9.0e-05
psoriasis -1.700 3.3e-05
tuberculosis and treatment for 6 months 1.100 8.8e-04

Gene RIF (3)

AA Sequence

MARHGPPWSRLDAQQERDVRELVRGVAGLQDEADPNFQLALNFAWSNFRFHRFLDVNSHKIEKTIEGIYE      1 - 70
KFVIHSDLSKAASWKRLTEEFLNAPLPSIKEIKTDAHYSILSLLLCLSDSPSNSSYVETPRNKEVEKKDD     71 - 140
FDWGKYLMEDEEMDIGPYMDTPNWSEESEEENDQQPLSREDSGIQVDRTPLEEQDQNRKLDPCISWKDEP    141 - 210
DDRSWLEHHVVHQYWTARPSQFPHSLHLHSNLAAVWDQHLYSSDPLYVPDDRVLVTETQVIRETLWLLSG    211 - 280
VKKLFIFQLIDGKVTVRNNIIVTHLTHSCLRSVLEQIAAYGQVVFRLQEFIDEVMGHSSESMLPGSGSVP    281 - 350
KKSTEAPFRTYQAFMWALYKYFISFKEELAEIEKCIINNDTTITLAIVVDKLAPRLSQLKVLHKVFSTGV    351 - 420
AEVPPDTRNVVRASHLLNTLYKAILEYDNVGEASEQTVSLLFSLWVETVRPYLQTVDEWIVHGHLWDGAR    421 - 490
EFIIQRNKNVPVNHRDFWYATYTLYSVSEKTENEEKMSDNASASSGSDQGPSSRQHTMVSFLKPVLKQII    491 - 560
MAGKSMQLLKNLQCAESTTCQAGARDAERKSLYTLFLESVQSRLRHGEDSTPQVLTEQQATKENLMKMQS    561 - 630
IAESHLELDDVHDPLLAINFARMYLEQSDFHEKFAGGDVCVDRSSESVTCQTFELTLRSCLYPHIDKQYL    631 - 700
DCCGNLMQTLKKDYRLVEYLQAMRNFFLMEGGDTMYDFYTSIFDKIREKETWQNVSFLNVQLQEAVGQRY    701 - 770
PEDSSRLSISFENVDTAKKKLPVHILDGLTLSYKVPWPVDIVISLECQKIYNQVFLLLLQIKWAKYSLDV    771 - 840
LLFGELVSTAEKPRLKEGLIHEQDTVAQFGPQKEPVRQQIHRMFLLRVKLMHFVNSLHNYIMTRILHSTG    841 - 910
LEFQHQVEEAKDLDQLIKIHYRYLSTIHDRCLLREKVSFVKEAIMKVLNLALMFADGWQAGLGTWRMESI    911 - 980
EKMESDFKNCHMFLVTILNKAVCRGSFPHLESLALSLMAGMEQS                              981 - 1024
//

Text Mined References (15)

PMID Year Title