Property Summary

NCBI Gene PubMed Count 50
Grant Count 26
R01 Count 19
Funding $2,140,793.42
PubMed Score 53.54
PubTator Score 70.62

Knowledge Summary

Patent

No data available

Expression

Gene RIF (25)

PMID Text
26025650 Erbin loss accelerates cell cycle though down-regulating p21 and p27 expression. Erbin is a novel negative modulator of Akt1-Skp2-p27 signaling pathway.
25521828 Erbin promotes tumourigenesis and tumour growth in colorectal cancer by stabilizing epidermal growth factor receptor
25288731 Erbin is an ErbB2 regulator for breast tumor formation and progression
24813123 analysis of the C-terminal ligand specificity of the erbin PDZ domain
24142719 Data suggest that Erbin can interact with Sema4C, and co-expression of Erbin blocks the process of Sema4C-induced epithelial-mesenchymal transition.
23711387 Data reveal that Erbin is a negative regulator of AKT activation and suggest that Erbin may play a role in breast cancer progression.
23524970 DSG1 and Erbin cooperate to repress MAPK signaling and promote keratinocyte differentiation.
22880131 These results unravel a critical role of c-Myb in promoting Erbin transcription in G2/M phase and also predict an unappreciated function of Erbin in cell cycle progression.
22745766 Data conclude that LAP2 is widely overexpressed in diverse digestive tract cancers and LAP2beta regulates motility of cancer cells and suggest that LAP2beta may have utility for diagnostics and therapeutics in digestive tract cancers.
21878490 ERBIN binds to SARA using a domain (amino acids 1208-1265) that also interacts with SMAD2 and SMAD3, which we have called the SSID (SARA- and SMAD-interacting domain)
More...

AA Sequence

MTTKRSLFVRLVPCRCLRGEEETVTTLDYSHCSLEQVPKEIFTFEKTLEELYLDANQIEELPKQLFNCQS      1 - 70
LHKLSLPDNDLTTLPASIANLINLRELDVSKNGIQEFPENIKNCKVLTIVEASVNPISKLPDGFSQLLNL     71 - 140
TQLYLNDAFLEFLPANFGRLTKLQILELRENQLKMLPKTMNRLTQLERLDLGSNEFTEVPEVLEQLSGLK    141 - 210
EFWMDANRLTFIPGFIGSLKQLTYLDVSKNNIEMVEEGISTCENLQDLLLSSNSLQQLPETIGSLKNITT    211 - 280
LKIDENQLMYLPDSIGGLISVEELDCSFNEVEALPSSIGQLTNLRTFAADHNYLQQLPPEIGSWKNITVL    281 - 350
FLHSNKLETLPEEMGDMQKLKVINLSDNRLKNLPFSFTKLQQLTAMWLSDNQSKPLIPLQKETDSETQKM    351 - 420
VLTNYMFPQQPRTEDVMFISDNESFNPSLWEEQRKQRAQVAFECDEDKDEREAPPREGNLKRYPTPYPDE    421 - 490
LKNMVKTVQTIVHRLKDEETNEDSGRDLKPHEDQQDINKDVGVKTSESTTTVKSKVDEREKYMIGNSVQK    491 - 560
ISEPEAEISPGSLPVTANMKASENLKHIVNHDDVFEESEELSSDEEMKMAEMRPPLIETSINQPKVVALS    561 - 630
NNKKDDTKETDSLSDEVTHNSNQNNSNCSSPSRMSDSVSLNTDSSQDTSLCSPVKQTHIDINSKIRQEDE    631 - 700
NFNSLLQNGDILNSSTEEKFKAHDKKDFNLPEYDLNVEERLVLIEKSVDSTATADDTHKLDHINMNLNKL    701 - 770
ITNDTFQPEIMERSKTQDIVLGTSFLSINSKEETEHLENGNKYPNLESVNKVNGHSEETSQSPNRTEPHD    771 - 840
SDCSVDLGISKSTEDLSPQKSGPVGSVVKSHSITNMEIGGLKIYDILSDNGPQQPSTTVKITSAVDGKNI    841 - 910
VRSKSATLLYDQPLQVFTGSSSSSDLISGTKAIFKFDSNHNPEEPNIIRGPTSGPQSAPQIYGPPQYNIQ    911 - 980
YSSSAAVKDTLWHSKQNPQIDHASFPPQLLPRSESTENQSYAKHSANMNFSNHNNVRANTAYHLHQRLGP    981 - 1050
ARHGEMWAISPNDRLIPAVTRSTIQRQSSVSSTASVNLGDPGSTRRAQIPEGDYLSYREFHSAGRTPPMM   1051 - 1120
PGSQRPLSARTYSIDGPNASRPQSARPSINEIPERTMSVSDFNYSRTSPSKRPNARVGSEHSLLDPPGKS   1121 - 1190
KVPRDWREQVLRHIEAKKLEKKHPQTSSSGDPCQDGIFISGQQNYSSATLSHKDVPPDSLMKMPLSNGQM   1191 - 1260
GQPLRPQANYSQIHHPPQASVARHPSREQLIDYLMLKVAHQPPYTQPHCSPRQGHELAKQEIRVRVEKDP   1261 - 1330
ELGFSISGGVGGRGNPFRPDDDGIFVTRVQPEGPASKLLQPGDKIIQANGYSFINIEHGQAVSLLKTFQN   1331 - 1400
TVELIIVREVSS                                                             1401 - 1412
//

Text Mined References (59)

PMID Year Title
26025650 2015 Erbin loss promotes cancer cell proliferation through feedback activation of Akt-Skp2-p27 signaling.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25521828 2015 Erbin interacts with c-Cbl and promotes tumourigenesis and tumour growth in colorectal cancer by preventing c-Cbl-mediated ubiquitination and down-regulation of EGFR.
25288731 2014 Role of Erbin in ErbB2-dependent breast tumor growth.
24813123 2014 Alteration of the C-terminal ligand specificity of the erbin PDZ domain by allosteric mutational effects.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24142719 2013 Erbin interacts with Sema4C and inhibits Sema4C-induced epithelial-mesenchymal transition in HK2 cells.
23711387 2013 Downregulation of Erbin in Her2-overexpressing breast cancer cells promotes cell migration and induces trastuzumab resistance.
23524970 2013 Desmoglein-1/Erbin interaction suppresses ERK activation to support epidermal differentiation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...