Property Summary

NCBI Gene PubMed Count 6
PubMed Score 12.40
PubTator Score 10.99

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (12)

Disease log2 FC p
acute myeloid leukemia -1.400 3.6e-02
adult high grade glioma -1.300 4.3e-03
astrocytic glioma -1.400 2.2e-02
Astrocytoma, Pilocytic -1.500 1.1e-05
atypical teratoid / rhabdoid tumor -1.500 1.1e-04
ependymoma -1.500 3.8e-02
glioblastoma -1.800 5.2e-05
group 3 medulloblastoma 1.100 2.8e-03
invasive ductal carcinoma 1.300 4.4e-03
oligodendroglioma -1.400 2.4e-02
ovarian cancer 1.500 3.0e-03
primary Sjogren syndrome 1.200 1.2e-03

Gene RIF (3)

AA Sequence

MEVAANCSLRVKRPLLDPRFEGYKLSLEPLPCYQLELDAAVAEVKLRDDQYTLEHMHAFGMYNYLHCDSW      1 - 70
YQDSVYYIDTLGRIMNLTVMLDTALGKPREVFRLPTDLTACDNRLCASIHFSSSTWVTLSDGTGRLYVIG     71 - 140
TGERGNSASEKWEIMFNEELGDPFIIIHSISLLNAEEHSIATLLLRIEKEELDMKGSGFYVSLEWVTISK    141 - 210
KNQDNKKYEIIKRDILRGKSVPHYAAIEPDGNGLMIVSYKSLTFVQAGQDLEENMDEDISEKIKEPLYYW    211 - 280
QQTEDDLTVTIRLPEDSTKEDIQIQFLPDHINIVLKDHQFLEGKLYSSIDHESSTWIIKESNSLEISLIK    281 - 350
KNEGLTWPELVIGDKQGELIRDSAQCAAIAERLMHLTSEELNPNPDKEKPPCNAQELEECDIFFEESSSL    351 - 420
CRFDGNTLKTTHVVNLGSNQYLFSVIVDPKEMPCFCLRHDVDALLWQPHSSKQDDMWEHIATFNALGYVQ    421 - 490
ASKRDKKFFACAPNYSYAALCECLRRVFIYRQPAPMSTVLYNRKEGRQVGQVAKQQVASLETNDPILGFQ    491 - 560
ATNERLFVLTTKNLFLIKVNTEN                                                   561 - 583
//

Text Mined References (14)

PMID Year Title