Property Summary

NCBI Gene PubMed Count 6
PubMed Score 11.69
PubTator Score 10.99

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
pilocytic astrocytoma 3086 6.72014055286712E-6
glioblastoma 5572 5.20194264449626E-5
atypical teratoid / rhabdoid tumor 4369 1.13338619279472E-4
primary Sjogren syndrome 789 0.00121273975259143
group 3 medulloblastoma 2254 0.00284584717661727
ovarian cancer 8492 0.00296070155434509
adult high grade glioma 2148 0.00425134274612158
invasive ductal carcinoma 2950 0.00440224222302246
astrocytic glioma 2241 0.022122762899872
oligodendroglioma 2849 0.0242124621275331
acute myeloid leukemia 785 0.0357043337890464
ependymoma 2514 0.0382059019181135
Disease Target Count Z-score Confidence
Globe disease 57 0.0 1.0
Disease Target Count Z-score Confidence
Chronic myeloid leukemia 11 3.319 1.7

Expression

  Differential Expression (12)

Disease log2 FC p
astrocytic glioma -1.400 0.022
ependymoma -1.500 0.038
oligodendroglioma -1.400 0.024
atypical teratoid / rhabdoid tumor -1.500 0.000
glioblastoma -1.800 0.000
adult high grade glioma -1.300 0.004
group 3 medulloblastoma 1.100 0.003
pilocytic astrocytoma -1.500 0.000
primary Sjogren syndrome 1.200 0.001
invasive ductal carcinoma 1.300 0.004
acute myeloid leukemia -1.400 0.036
ovarian cancer 1.500 0.003

Synonym

Accession Q96RS6 B4DVX6 Q4G130 Q8NDQ5 Q8NG18 Q96SI4 Q9BVR5
Symbols CML66
OVA66

Gene

  Ortholog (13)

Gene RIF (3)

PMID Text
18754882 study identified a novel gene, OVA66, which was expressed significantly higher in cancer patients than normal controls; IgG level against OVA66 was significantly elevated in the serum of cancer patients from different histological types of cancer [OVA66]
18534745 CML66 may play an oncogenic role in ways of favoring tumor cells proliferation, invasion and metastasis-associated with multiple pathways.
14688378 An alternative promoter (CML66-S short isoform) has been identified in combination with alternative splicing as a novel mechanism for regulation of the epitope generation of a self-tumor antigen.

AA Sequence

MEVAANCSLRVKRPLLDPRFEGYKLSLEPLPCYQLELDAAVAEVKLRDDQYTLEHMHAFGMYNYLHCDSW      1 - 70
YQDSVYYIDTLGRIMNLTVMLDTALGKPREVFRLPTDLTACDNRLCASIHFSSSTWVTLSDGTGRLYVIG     71 - 140
TGERGNSASEKWEIMFNEELGDPFIIIHSISLLNAEEHSIATLLLRIEKEELDMKGSGFYVSLEWVTISK    141 - 210
KNQDNKKYEIIKRDILRGKSVPHYAAIEPDGNGLMIVSYKSLTFVQAGQDLEENMDEDISEKIKEPLYYW    211 - 280
QQTEDDLTVTIRLPEDSTKEDIQIQFLPDHINIVLKDHQFLEGKLYSSIDHESSTWIIKESNSLEISLIK    281 - 350
KNEGLTWPELVIGDKQGELIRDSAQCAAIAERLMHLTSEELNPNPDKEKPPCNAQELEECDIFFEESSSL    351 - 420
CRFDGNTLKTTHVVNLGSNQYLFSVIVDPKEMPCFCLRHDVDALLWQPHSSKQDDMWEHIATFNALGYVQ    421 - 490
ASKRDKKFFACAPNYSYAALCECLRRVFIYRQPAPMSTVLYNRKEGRQVGQVAKQQVASLETNDPILGFQ    491 - 560
ATNERLFVLTTKNLFLIKVNTEN                                                   561 - 583
//

Text Mined References (14)

PMID Year Title
25036637 2014 A quantitative chaperone interaction network reveals the architecture of cellular protein homeostasis pathways.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22002106 2012 Systematic analysis of protein pools, isoforms, and modifications affecting turnover and subcellular localization.
21269460 2011 Initial characterization of the human central proteome.
18754882 2008 Humoral immune responses against tumor-associated antigen OVA66 originally defined by serological analysis of recombinant cDNA expression libraries and its potentiality in cellular immunity.
18534745 2008 RNA interference targeting CML66, a novel tumor antigen, inhibits proliferation, invasion and metastasis of HeLa cells.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...