Property Summary

NCBI Gene PubMed Count 43
Grant Count 67
R01 Count 58
Funding $4,734,646.13
PubMed Score 116.76
PubTator Score 80.58

Knowledge Summary

Patent (3,875)

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytoma -1.400 0.000
ependymoma -2.600 0.000
oligodendroglioma -1.400 0.000
psoriasis 3.000 0.000
glioblastoma -2.600 0.000
osteosarcoma -3.001 0.000
medulloblastoma -1.900 0.000
cystic fibrosis 1.054 0.000
atypical teratoid / rhabdoid tumor -2.500 0.000
medulloblastoma, large-cell -1.500 0.000
primitive neuroectodermal tumor -2.100 0.000
pancreatic ductal adenocarcinoma liver m... 1.494 0.006
adult high grade glioma -2.500 0.000
pilocytic astrocytoma -2.300 0.000
aldosterone-producing adenoma -1.119 0.021
subependymal giant cell astrocytoma -3.318 0.001
Pick disease -1.600 0.001
ovarian cancer 1.700 0.000

Gene

PDB

2ZV2  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (35)

PMID Text
27151216 Site-directed mutagenesis analysis revealed that Leu(358) in CaMKKbeta/Ile(322) in CaMKKalpha confer, at least in part, a distinct recognition of AMPK but not of CaMKIalpha.
26824050 Clopidogrel diminishes TNFalpha-stimulated VCAM-1 expression at least in part via HO-1 induction and CaMKKbeta/AMPK/Nrf2 pathway in endothelial cells.
26552607 CaMKK2 (and Nup62) are required for optimal androgen receptor transcriptional activity in castrate resistant prostate cancer cells.
25847065 CAMKK2 protein is highly up regulated in hepatocellular carcinoma.
25756516 Silencing of CAMKK2 using siRNA significantly reduced cell proliferation, colony formation and invasion of gastric cancer cells.
25679868 CaMKK2 plays a pivotal role in the calcium signaling cascade regulating adrenal aldosterone production.
25590814 CaMKKbeta-AMPKalpha2 signaling contributes to mitotic Golgi fragmentation and the G2/M transition in mammalian cells.
25394900 PCa patients with miR-224-low/CAMKK2-high expression more frequently had shorter overall survival.
23958956 evidence supports that CAMKK2 is a novel schizophrenia susceptibility gene.
23754392 Pulsatile shear stress mimicking atheroprotective flow increases the level of sirtuin (SIRT)1 in cultured endothelial cells by enhancing its stability, an effect abolished by inhibition or knockdown of CaMKKbeta.
More...

AA Sequence

MSSCVSSQPSSNRAAPQDELGGRGSSSSESQKPCEALRGLSSLSIHLGMESFIVVTECEPGCAVDLGLAR      1 - 70
DRPLEADGQEVPLDTSGSQARPHLSGRKLSLQERSQGGLAAGGSLDMNGRCICPSLPYSPVSSPQSSPRL     71 - 140
PRRPTVESHHVSITGMQDCVQLNQYTLKDEIGKGSYGVVKLAYNENDNTYYAMKVLSKKKLIRQAGFPRR    141 - 210
PPPRGTRPAPGGCIQPRGPIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPT    211 - 280
LKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGT    281 - 350
PAFMAPESLSETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFPDQPDIAEDLK    351 - 420
DLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIPSLATVILVKTM    421 - 490
IRKRSFGNPFEGSRREERSLSAPGNLLTKKPTRECESLSELKEARQRRQPPGHRPAPRGGGGSALVRGSP    491 - 560
CVESCWAPAPGSPARMHPLRPEEAMEPE                                              561 - 588
//

Text Mined References (52)

PMID Year Title
27151216 2016 Differential AMP-activated Protein Kinase (AMPK) Recognition Mechanism of Ca2+/Calmodulin-dependent Protein Kinase Kinase Isoforms.
26824050 2016 Clopidogrel Protects Endothelium by Hindering TNF?-Induced VCAM-1 Expression through CaMKK?/AMPK/Nrf2 Pathway.
26552607 2016 Nucleoporin 62 and Ca(2+)/calmodulin dependent kinase kinase 2 regulate androgen receptor activity in castrate resistant prostate cancer cells.
25847065 2015 The camKK2/camKIV relay is an essential regulator of hepatic cancer.
25756516 2015 Calcium calmodulin dependent kinase kinase 2 - a novel therapeutic target for gastric adenocarcinoma.
25679868 2015 Role of Ca(2+)/calmodulin-dependent protein kinase kinase in adrenal aldosterone production.
25590814 2015 CaMKK?-AMPK?2 signaling contributes to mitotic Golgi fragmentation and the G2/M transition in mammalian cells.
25394900 2015 MicroRNA-224 and its target CAMKK2 synergistically influence tumor progression and patient prognosis in prostate cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23958956 2014 Convergent lines of evidence support CAMKK2 as a schizophrenia susceptibility gene.
More...