Property Summary

NCBI Gene PubMed Count 75
PubMed Score 156.12
PubTator Score 134.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (7)

Disease log2 FC p
colon cancer 2.500 3.3e-08
group 3 medulloblastoma 1.700 1.1e-04
lung cancer 2.300 5.9e-04
malignant mesothelioma 1.200 4.5e-06
medulloblastoma, large-cell 1.900 3.4e-05
non-small cell lung cancer 1.022 1.4e-11
osteosarcoma -1.295 4.9e-05

Gene RIF (53)

AA Sequence

MWVLLRSGYPLRILLPLRGEWMGRRGLPRNLAPGPPRRRYRKETLQALDMPVLPVTATEIRQYLRGHGIP      1 - 70
FQDGHSCLRALSPFAESSQLKGQTGVTTSFSLFIDKTTGHFLCMTSLAEGSWEDFQASVEGRGDGAREGF     71 - 140
LLSKAPEFEDSEEVRRIWNRAIPLWELPDQEEVQLADTMFGLTKVTDDTLKRFSVRYLRPARSLVFPWFS    141 - 210
PGGSGLRGLKLLEAKCQGDGVSYEETTIPRPSAYHNLFGLPLISRRDAEVVLTSRELDSLALNQSTGLPT    211 - 280
LTLPRGTTCLPPALLPYLEQFRRIVFWLGDDLRSWEAAKLFARKLNPKRCFLVRPGDQQPRPLEALNGGF    281 - 350
NLSRILRTALPAWHKSIVSFRQLREEVLGELSNVEQAAGLRWSRFPDLNRILKGHRKGELTVFTGPTGSG    351 - 420
KTTFISEYALDLCSQGVNTLWGSFEISNVRLARVMLTQFAEGRLEDQLDKYDHWADRFEDLPLYFMTFHG    421 - 490
QQSIRTVIDTMQHAVYVYDICHVIIDNLQFMMGHEQLSTDRIAAQDYIIGVFRKFATDNNCHVTLVIHPR    491 - 560
KEDDDKELQTASIFGSAKASQEADNVLILQDRKLVTGPGKRYLQVSKNRFDGDVGVFPLEFNKNSLTFSI    561 - 630
PPKNKARLKKIKDDTGPVAKKPSSGKKGATTQNSEICSGQAPTPDQPDTSKRSK                    631 - 684
//

Text Mined References (77)

PMID Year Title