Property Summary

NCBI Gene PubMed Count 32
PubMed Score 82.36
PubTator Score 45.52

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
interstitial cystitis -1.300 5.5e-03
lung adenocarcinoma -1.100 8.5e-06
osteosarcoma -1.397 2.3e-04
pancreatic cancer -1.200 6.0e-04
pancreatic ductal adenocarcinoma liver m... -1.049 2.6e-03

Gene RIF (17)

AA Sequence

MAAASAVSVLLVAAERNRWHRLPSLLLPPRTWVWRQRTMKYTTATGRNITKVLIANRGEIACRVMRTAKK      1 - 70
LGVQTVAVYSEADRNSMHVDMADEAYSIGPAPSQQSYLSMEKIIQVAKTSAAQAIHPGCGFLSENMEFAE     71 - 140
LCKQEGIIFIGPPPSAIRDMGIKSTSKSIMAAAGVPVVEGYHGEDQSDQCLKEHARRIGYPVMIKAVRGG    141 - 210
GGKGMRIVRSEQEFQEQLESARREAKKSFNDDAMLIEKFVDTPRHVEVQVFGDHHGNAVYLFERDCSVQR    211 - 280
RHQKIIEEAPAPGIKSEVRKKLGEAAVRAAKAVNYVGAGTVEFIMDSKHNFCFMEMNTRLQVEHPVTEMI    281 - 350
TGTDLVEWQLRIAAGEKIPLSQEEITLQGHAFEARIYAEDPSNNFMPVAGPLVHLSTPRADPSTRIETGV    351 - 420
RQGDEVSVHYDPMIAKLVVWAADRQAALTKLRYSLRQYNIVGLHTNIDFLLNLSGHPEFEAGNVHTDFIP    421 - 490
QHHKQLLLSRKAAAKESLCQAALGLILKEKAMTDTFTLQAHDQFSPFSSSSGRRLNISYTRNMTLKDGKN    491 - 560
NVAIAVTYNHDGSYSMQIEDKTFQVLGNLYSEGDCTYLKCSVNGVASKAKLIILENTIYLFSKEGSIEID    561 - 630
IPVPKYLSSVSSQETQGGPLAPMTGTIEKVFVKAGDKVKAGDSLMVMIAMKMEHTIKSPKDGTVKKVFYR    631 - 700
EGAQANRHTPLVEFEEEESDKRESE                                                 701 - 725
//

Text Mined References (38)

PMID Year Title