Property Summary

NCBI Gene PubMed Count 13
Grant Count 2
Funding $183,706.2
PubMed Score 8.08
PubTator Score 5.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
pancreatic cancer 1.200 0.007
osteosarcoma 1.588 0.003
atypical teratoid / rhabdoid tumor -1.600 0.000
group 4 medulloblastoma -1.600 0.004
medulloblastoma, large-cell -2.200 0.000
hereditary spastic paraplegia -1.020 0.021
juvenile dermatomyositis 1.063 0.000
tuberculosis and treatment for 6 months -1.800 0.000
Breast cancer 2.100 0.039
adult high grade glioma -1.300 0.004
pancreatic carcinoma 1.200 0.007
lung adenocarcinoma 1.097 0.000
ovarian cancer 3.300 0.000
dermatomyositis 1.100 0.005

Synonym

Accession Q96RQ1 A6NHH6 Q53GY2 Q8N2Q9 Q9BVV9 Q9NZA3
Symbols PTX1
CDA14
Erv41
cd002

Gene

 Grant Application (2)

Gene RIF (6)

PMID Text
24303950 A variant of ERGIC2 with four coding bases deleted has an abrogated function as a transport shuttle, but does continue to upregulate the heme oxygenase 1 gene, suggesting that it may be involved in the oxidative stress pathway.
22190034 HIV-1 gp160 is identified to have a physical interaction with ERGIC and golgi 2 (ERGIC2) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
17980171 CDA14 participated in the elongation factor 1alpha regulated mechanisms
16989575 Ectopic expression of a partial sequence of PTX1 (Met84 - Leu225) as a VP22-fusion protein in prostate cancer cell line, PC-3, induced cellular senescence.
15308636 ERGIC-32 functions as a modulator of the hErv41-hErv46 complex by stabilizing hErv46
12932305 may play an important role in the growth and tumorigenicity of PC-3 prostate tumor cells

AA Sequence

MRRLNRKKTLSLVKELDAFPKVPESYVETSASGGTVSLIAFTTMALLTIMEFSVYQDTWMKYEYEVDKDF      1 - 70
SSKLRINIDITVAMKCQYVGADVLDLAETMVASADGLVYEPTVFDLSPQQKEWQRMLQLIQSRLQEEHSL     71 - 140
QDVIFKSAFKSTSTALPPREDDSSQSPNACRIHGHLYVNKVAGNFHITVGKAIPHPRGHAHLAALVNHES    141 - 210
YNFSHRIDHLSFGELVPAIINPLDGTEKIAIDHNQMFQYFITVVPTKLHTYKISADTHQFSVTERERIIN    211 - 280
HAAGSHGVSGIFMKYDLSSLMVTVTEEHMPFWQFFVRLCGIVGGIFSTTGMLHGIGKFIVEIICCRFRLG    281 - 350
SYKPVNSVPFEDGHTDNHLPLLENNTH                                               351 - 377
//

Text Mined References (14)

PMID Year Title
24768165 2014 WLS retrograde transport to the endoplasmic reticulum during Wnt secretion.
24303950 2014 Characterization of a variant of ERGIC2 transcript.
19946888 2010 Defining the membrane proteome of NK cells.
17980171 2008 The possible interaction of CDA14 and protein elongation factor 1alpha.
16989575 2006 PTX1(ERGIC2)-VP22 fusion protein upregulates interferon-beta in prostate cancer cell line PC-3.
16541075 2006 The finished DNA sequence of human chromosome 12.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15308636 2004 Proteomics of endoplasmic reticulum-Golgi intermediate compartment (ERGIC) membranes from brefeldin A-treated HepG2 cells identifies ERGIC-32, a new cycling protein that interacts with human Erv46.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12932305 2003 Effects of PTX1 expression on growth and tumorigenicity of the prostate cancer cell line PC-3.
More...