Property Summary

NCBI Gene PubMed Count 13
PubMed Score 8.58
PubTator Score 5.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.300 3.7e-03
atypical teratoid / rhabdoid tumor -1.600 1.2e-04
Breast cancer 2.100 3.9e-02
dermatomyositis 1.100 5.4e-03
group 4 medulloblastoma -1.600 4.3e-03
hereditary spastic paraplegia -1.020 2.1e-02
juvenile dermatomyositis 1.063 2.6e-11
lung adenocarcinoma 1.097 4.7e-05
medulloblastoma, large-cell -2.200 2.9e-06
osteosarcoma 1.588 2.8e-03
ovarian cancer -1.200 5.6e-03
pancreatic cancer 1.200 6.5e-03
pancreatic carcinoma 1.200 6.5e-03
tuberculosis and treatment for 3 months -1.200 4.9e-04

Gene RIF (7)

AA Sequence

MRRLNRKKTLSLVKELDAFPKVPESYVETSASGGTVSLIAFTTMALLTIMEFSVYQDTWMKYEYEVDKDF      1 - 70
SSKLRINIDITVAMKCQYVGADVLDLAETMVASADGLVYEPTVFDLSPQQKEWQRMLQLIQSRLQEEHSL     71 - 140
QDVIFKSAFKSTSTALPPREDDSSQSPNACRIHGHLYVNKVAGNFHITVGKAIPHPRGHAHLAALVNHES    141 - 210
YNFSHRIDHLSFGELVPAIINPLDGTEKIAIDHNQMFQYFITVVPTKLHTYKISADTHQFSVTERERIIN    211 - 280
HAAGSHGVSGIFMKYDLSSLMVTVTEEHMPFWQFFVRLCGIVGGIFSTTGMLHGIGKFIVEIICCRFRLG    281 - 350
SYKPVNSVPFEDGHTDNHLPLLENNTH                                               351 - 377
//

Text Mined References (14)

PMID Year Title